BLASTX nr result
ID: Papaver27_contig00028554
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00028554 (689 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003610646.1| hypothetical protein MTR_5g005410 [Medicago ... 60 5e-07 >ref|XP_003610646.1| hypothetical protein MTR_5g005410 [Medicago truncatula] gi|355511981|gb|AES93604.1| hypothetical protein MTR_5g005410 [Medicago truncatula] Length = 389 Score = 60.5 bits (145), Expect = 5e-07 Identities = 37/119 (31%), Positives = 60/119 (50%) Frame = +3 Query: 183 SRITDTYHCSMSTIRKLQDPQSELLLLRSCTGVS*LYFTMRTTRPSTLQQGQVCFDGHLT 362 SR+ + H + +L+DPQ E+ LLRSC G++ L+F Sbjct: 104 SRVVELMHL----LPRLRDPQREIFLLRSCMGITKLFF---------------------- 137 Query: 363 QYLQQLITGDGDGFGTLQQRIATLPMKHGGLGIYFMADTSKNCFLASHAQTRSLQISIL 539 ++ ++ G FG L R+++LP++ GLG+Y + S + F+AS AQ+ LQ IL Sbjct: 138 --VEDIVVCGGPFFGDLHWRLSSLPIRSEGLGLYSAVEASLHAFVASRAQSWVLQYHIL 194