BLASTX nr result
ID: Papaver27_contig00027662
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00027662 (510 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006591188.1| PREDICTED: uridine 5'-monophosphate synthase... 44 6e-06 >ref|XP_006591188.1| PREDICTED: uridine 5'-monophosphate synthase-like isoform X2 [Glycine max] Length = 478 Score = 43.9 bits (102), Expect(2) = 6e-06 Identities = 20/33 (60%), Positives = 24/33 (72%) Frame = -1 Query: 240 YSERAKTAKTQTGKKLFVVMASKEHNLCLDADV 142 + ERAK +K GK+LF +MA KE NLCL ADV Sbjct: 222 FGERAKLSKNPMGKRLFEIMAEKESNLCLAADV 254 Score = 31.6 bits (70), Expect(2) = 6e-06 Identities = 12/19 (63%), Positives = 16/19 (84%) Frame = -3 Query: 118 IAGKVDPEICMVNTHVDLY 62 IA KV PEIC++ THVD++ Sbjct: 263 IAEKVGPEICLLKTHVDIF 281