BLASTX nr result
ID: Papaver27_contig00027610
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00027610 (798 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002525169.1| conserved hypothetical protein [Ricinus comm... 58 4e-06 >ref|XP_002525169.1| conserved hypothetical protein [Ricinus communis] gi|223535466|gb|EEF37135.1| conserved hypothetical protein [Ricinus communis] Length = 90 Score = 58.2 bits (139), Expect = 4e-06 Identities = 30/60 (50%), Positives = 37/60 (61%) Frame = -2 Query: 539 MGLKFGVAFGFILVLCLSRPILSQGIRSNVVELMKSDEIYEIDYRGPETHSKRIPPPDRS 360 MGLK F+L L L+ P +S+G + V +IYEIDYRGPETHS +PPP RS Sbjct: 1 MGLKSSFTSFFLLYLLLALPCISRGTEGSQVA---DSDIYEIDYRGPETHSSAMPPPGRS 57