BLASTX nr result
ID: Papaver27_contig00027494
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00027494 (522 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU30916.1| hypothetical protein MIMGU_mgv1a002827mg [Mimulus... 58 2e-06 >gb|EYU30916.1| hypothetical protein MIMGU_mgv1a002827mg [Mimulus guttatus] Length = 634 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = -3 Query: 442 IHRWISAKPHVG*WIITASNEFLSVGLHKQDLTSHACPLSIAV 314 +H WIS +PHVG W+IT S+EF + G K DLTSHA P S+AV Sbjct: 214 VHGWISNRPHVGFWVITPSDEFRAAGPVKPDLTSHAGPTSLAV 256