BLASTX nr result
ID: Papaver27_contig00026893
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00026893 (406 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006379439.1| hypothetical protein POPTR_0008s01400g [Popu... 65 1e-08 ref|XP_006449974.1| hypothetical protein CICLE_v10017450mg [Citr... 65 1e-08 ref|XP_002517758.1| C, putative [Ricinus communis] gi|223543030|... 62 8e-08 ref|XP_007213142.1| hypothetical protein PRUPE_ppa024549mg, part... 60 4e-07 ref|XP_004293424.1| PREDICTED: cell wall / vacuolar inhibitor of... 59 7e-07 ref|XP_002525233.1| Pectinesterase inhibitor, putative [Ricinus ... 57 3e-06 gb|EXB64629.1| Pectinesterase inhibitor [Morus notabilis] 56 4e-06 >ref|XP_006379439.1| hypothetical protein POPTR_0008s01400g [Populus trichocarpa] gi|118482318|gb|ABK93085.1| unknown [Populus trichocarpa] gi|550332158|gb|ERP57236.1| hypothetical protein POPTR_0008s01400g [Populus trichocarpa] Length = 184 Score = 65.1 bits (157), Expect = 1e-08 Identities = 29/51 (56%), Positives = 37/51 (72%) Frame = +3 Query: 252 AGKKLNKLVDSICNQTPNHKFCVDAIYTDPRASEADIILLAYISFGLAYTN 404 A K +LVD +CNQT N+ CV+A+Y+D R +AD LA+ISFGLAYTN Sbjct: 29 AADKPTELVDKVCNQTSNYTLCVEALYSDSRTPDADSYTLAFISFGLAYTN 79 >ref|XP_006449974.1| hypothetical protein CICLE_v10017450mg [Citrus clementina] gi|557552585|gb|ESR63214.1| hypothetical protein CICLE_v10017450mg [Citrus clementina] Length = 187 Score = 64.7 bits (156), Expect = 1e-08 Identities = 26/49 (53%), Positives = 37/49 (75%) Frame = +3 Query: 258 KKLNKLVDSICNQTPNHKFCVDAIYTDPRASEADIILLAYISFGLAYTN 404 +K+ ++VD +C +T N+K CVD +Y+DPR +AD LAY+SFGLAY N Sbjct: 34 RKVTEIVDKVCKKTSNYKNCVDTLYSDPRTPDADRYTLAYVSFGLAYAN 82 >ref|XP_002517758.1| C, putative [Ricinus communis] gi|223543030|gb|EEF44565.1| C, putative [Ricinus communis] Length = 154 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/44 (61%), Positives = 33/44 (75%) Frame = +3 Query: 267 NKLVDSICNQTPNHKFCVDAIYTDPRASEADIILLAYISFGLAY 398 N LVD +CNQT N+ FCV ++Y+DPR +AD LAYIS GLAY Sbjct: 31 NALVDKVCNQTSNYTFCVGSLYSDPRTPDADRYTLAYISVGLAY 74 >ref|XP_007213142.1| hypothetical protein PRUPE_ppa024549mg, partial [Prunus persica] gi|462409007|gb|EMJ14341.1| hypothetical protein PRUPE_ppa024549mg, partial [Prunus persica] Length = 189 Score = 59.7 bits (143), Expect = 4e-07 Identities = 25/45 (55%), Positives = 34/45 (75%) Frame = +3 Query: 270 KLVDSICNQTPNHKFCVDAIYTDPRASEADIILLAYISFGLAYTN 404 KLVD +C+ T ++ CV+++YTDPR ADI +LAYISF LA+ N Sbjct: 37 KLVDEVCHSTSSYSLCVESLYTDPRTPSADIYVLAYISFRLAFLN 81 >ref|XP_004293424.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 2-like [Fragaria vesca subsp. vesca] Length = 224 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/49 (55%), Positives = 37/49 (75%), Gaps = 1/49 (2%) Frame = +3 Query: 261 KLNKLVDSICNQT-PNHKFCVDAIYTDPRASEADIILLAYISFGLAYTN 404 K KLVD++C +T ++ FCV+++Y+DPR AD +LAYISFGLAY N Sbjct: 71 KPTKLVDAVCRKTNSSYSFCVESLYSDPRTPTADSYVLAYISFGLAYLN 119 >ref|XP_002525233.1| Pectinesterase inhibitor, putative [Ricinus communis] gi|223535530|gb|EEF37199.1| Pectinesterase inhibitor, putative [Ricinus communis] Length = 175 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/45 (53%), Positives = 33/45 (73%) Frame = +3 Query: 270 KLVDSICNQTPNHKFCVDAIYTDPRASEADIILLAYISFGLAYTN 404 KLVD +C QT ++ FCV+++Y+D R +AD LA+IS GLAY N Sbjct: 28 KLVDKVCQQTSSYSFCVNSLYSDSRTPDADEYTLAFISVGLAYAN 72 >gb|EXB64629.1| Pectinesterase inhibitor [Morus notabilis] Length = 197 Score = 56.2 bits (134), Expect = 4e-06 Identities = 23/48 (47%), Positives = 32/48 (66%) Frame = +3 Query: 261 KLNKLVDSICNQTPNHKFCVDAIYTDPRASEADIILLAYISFGLAYTN 404 K +LV +CN+T N+ FCV A+Y DPR D LA+++FG+AY N Sbjct: 45 KPTELVSDVCNRTSNYTFCVSALYADPRTPTTDAYGLAFVAFGMAYLN 92