BLASTX nr result
ID: Papaver27_contig00026185
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00026185 (1134 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006849208.1| hypothetical protein AMTR_s00027p00222730 [A... 59 5e-06 >ref|XP_006849208.1| hypothetical protein AMTR_s00027p00222730 [Amborella trichopoda] gi|548852695|gb|ERN10789.1| hypothetical protein AMTR_s00027p00222730 [Amborella trichopoda] Length = 435 Score = 58.5 bits (140), Expect = 5e-06 Identities = 34/88 (38%), Positives = 49/88 (55%), Gaps = 5/88 (5%) Frame = +1 Query: 133 DHSTPSRYKRPYAYEDDERLVSRPLTRSTRARWSELEADDYAEHDVSSYDEYSRNMPDDR 312 D+ + S KRPY+ D + ++SR +R +R+R +LE + H V +Y YSR P+DR Sbjct: 349 DYYSFSGSKRPYSSLDGDIVLSRSFSRGSRSR-EDLEVTRQSHHGVPAYGTYSRFAPEDR 407 Query: 313 I-----VYETRGRASQYVPKSGASRSYY 381 Y +R SQY+ G SRSYY Sbjct: 408 YDYGSSTYSSRDSGSQYLSGGGGSRSYY 435