BLASTX nr result
ID: Papaver27_contig00025624
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00025624 (421 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006350582.1| PREDICTED: RNA polymerase sigma factor sigE,... 76 4e-12 ref|XP_004234180.1| PREDICTED: RNA polymerase sigma factor sigE,... 76 4e-12 ref|XP_004234179.1| PREDICTED: RNA polymerase sigma factor sigE,... 76 4e-12 gb|EPS69584.1| hypothetical protein M569_05182, partial [Genlise... 75 9e-12 ref|XP_006376620.1| RNA polymerase sigma subunit SigE family pro... 75 1e-11 ref|XP_006422121.1| hypothetical protein CICLE_v10004760mg [Citr... 73 4e-11 ref|XP_006847349.1| hypothetical protein AMTR_s00015p00252960 [A... 73 4e-11 ref|XP_004308009.1| PREDICTED: RNA polymerase sigma factor sigE,... 73 4e-11 ref|XP_007038959.1| Sigma factor E isoform 1 [Theobroma cacao] g... 73 5e-11 ref|XP_007219010.1| hypothetical protein PRUPE_ppa004259mg [Prun... 73 5e-11 ref|XP_004166500.1| PREDICTED: RNA polymerase sigma factor sigE,... 72 6e-11 ref|XP_004149458.1| PREDICTED: RNA polymerase sigma factor sigE,... 72 6e-11 gb|EYU25198.1| hypothetical protein MIMGU_mgv1a004656mg [Mimulus... 72 8e-11 gb|EXB72455.1| RNA polymerase sigma factor rpoD [Morus notabilis] 72 8e-11 ref|XP_002268709.1| PREDICTED: RNA polymerase sigma factor rpoD ... 72 8e-11 ref|XP_007161346.1| hypothetical protein PHAVU_001G061400g [Phas... 72 1e-10 ref|NP_001254001.1| RNA polymerase sigma factor rpoD-like [Glyci... 72 1e-10 ref|XP_002513587.1| RNA polymerase sigma factor rpoD, putative [... 70 2e-10 ref|XP_006593758.1| PREDICTED: RNA polymerase sigma factor sigE,... 70 3e-10 ref|XP_006374135.1| hypothetical protein POPTR_0015s02320g [Popu... 70 3e-10 >ref|XP_006350582.1| PREDICTED: RNA polymerase sigma factor sigE, chloroplastic/mitochondrial-like [Solanum tuberosum] Length = 516 Score = 76.3 bits (186), Expect = 4e-12 Identities = 36/38 (94%), Positives = 38/38 (100%) Frame = -3 Query: 419 EIAGNLNISREMVRKHEVKALMKLKHPTRVDYLRRHIF 306 EIAGNLNISREMVRKHEVKALMKLKHPTRVDY+RR+IF Sbjct: 479 EIAGNLNISREMVRKHEVKALMKLKHPTRVDYVRRYIF 516 >ref|XP_004234180.1| PREDICTED: RNA polymerase sigma factor sigE, chloroplastic/mitochondrial-like isoform 2 [Solanum lycopersicum] Length = 487 Score = 76.3 bits (186), Expect = 4e-12 Identities = 36/38 (94%), Positives = 38/38 (100%) Frame = -3 Query: 419 EIAGNLNISREMVRKHEVKALMKLKHPTRVDYLRRHIF 306 EIAGNLNISREMVRKHEVKALMKLKHPTRVDY+RR+IF Sbjct: 450 EIAGNLNISREMVRKHEVKALMKLKHPTRVDYVRRYIF 487 >ref|XP_004234179.1| PREDICTED: RNA polymerase sigma factor sigE, chloroplastic/mitochondrial-like isoform 1 [Solanum lycopersicum] Length = 516 Score = 76.3 bits (186), Expect = 4e-12 Identities = 36/38 (94%), Positives = 38/38 (100%) Frame = -3 Query: 419 EIAGNLNISREMVRKHEVKALMKLKHPTRVDYLRRHIF 306 EIAGNLNISREMVRKHEVKALMKLKHPTRVDY+RR+IF Sbjct: 479 EIAGNLNISREMVRKHEVKALMKLKHPTRVDYVRRYIF 516 >gb|EPS69584.1| hypothetical protein M569_05182, partial [Genlisea aurea] Length = 488 Score = 75.1 bits (183), Expect = 9e-12 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = -3 Query: 419 EIAGNLNISREMVRKHEVKALMKLKHPTRVDYLRRHIF 306 E+AGNLNISREMVRKHEVKALMKLKHP RVDYLRR+IF Sbjct: 450 EVAGNLNISREMVRKHEVKALMKLKHPARVDYLRRYIF 487 >ref|XP_006376620.1| RNA polymerase sigma subunit SigE family protein [Populus trichocarpa] gi|550326141|gb|ERP54417.1| RNA polymerase sigma subunit SigE family protein [Populus trichocarpa] Length = 512 Score = 74.7 bits (182), Expect = 1e-11 Identities = 35/37 (94%), Positives = 37/37 (100%) Frame = -3 Query: 419 EIAGNLNISREMVRKHEVKALMKLKHPTRVDYLRRHI 309 EIAGNLNISREMVRKHEVKALMKLKHPTRVDYLRR++ Sbjct: 475 EIAGNLNISREMVRKHEVKALMKLKHPTRVDYLRRYV 511 >ref|XP_006422121.1| hypothetical protein CICLE_v10004760mg [Citrus clementina] gi|567858878|ref|XP_006422122.1| hypothetical protein CICLE_v10004760mg [Citrus clementina] gi|568874930|ref|XP_006490565.1| PREDICTED: RNA polymerase sigma factor sigE, chloroplastic/mitochondrial-like isoform X1 [Citrus sinensis] gi|568874932|ref|XP_006490566.1| PREDICTED: RNA polymerase sigma factor sigE, chloroplastic/mitochondrial-like isoform X2 [Citrus sinensis] gi|568874934|ref|XP_006490567.1| PREDICTED: RNA polymerase sigma factor sigE, chloroplastic/mitochondrial-like isoform X3 [Citrus sinensis] gi|557523994|gb|ESR35361.1| hypothetical protein CICLE_v10004760mg [Citrus clementina] gi|557523995|gb|ESR35362.1| hypothetical protein CICLE_v10004760mg [Citrus clementina] Length = 513 Score = 73.2 bits (178), Expect = 4e-11 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = -3 Query: 419 EIAGNLNISREMVRKHEVKALMKLKHPTRVDYLRRHI 309 EIAGNLNISREMVRKHEVK LMKLKHPTRVDYLR+H+ Sbjct: 476 EIAGNLNISREMVRKHEVKGLMKLKHPTRVDYLRQHM 512 >ref|XP_006847349.1| hypothetical protein AMTR_s00015p00252960 [Amborella trichopoda] gi|548850426|gb|ERN08930.1| hypothetical protein AMTR_s00015p00252960 [Amborella trichopoda] Length = 128 Score = 73.2 bits (178), Expect = 4e-11 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -3 Query: 419 EIAGNLNISREMVRKHEVKALMKLKHPTRVDYLRRHI 309 EIAGNLNISREMVRKHEVKALMKLKHP RVDYLRR+I Sbjct: 91 EIAGNLNISREMVRKHEVKALMKLKHPARVDYLRRYI 127 >ref|XP_004308009.1| PREDICTED: RNA polymerase sigma factor sigE, chloroplastic/mitochondrial-like [Fragaria vesca subsp. vesca] Length = 520 Score = 73.2 bits (178), Expect = 4e-11 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -3 Query: 419 EIAGNLNISREMVRKHEVKALMKLKHPTRVDYLRRHI 309 EIAGNLNISREMVRKHEVKALMKLKHP RVDYLRR+I Sbjct: 483 EIAGNLNISREMVRKHEVKALMKLKHPARVDYLRRYI 519 >ref|XP_007038959.1| Sigma factor E isoform 1 [Theobroma cacao] gi|590673674|ref|XP_007038960.1| Sigma factor E isoform 1 [Theobroma cacao] gi|508776204|gb|EOY23460.1| Sigma factor E isoform 1 [Theobroma cacao] gi|508776205|gb|EOY23461.1| Sigma factor E isoform 1 [Theobroma cacao] Length = 516 Score = 72.8 bits (177), Expect = 5e-11 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = -3 Query: 419 EIAGNLNISREMVRKHEVKALMKLKHPTRVDYLRRHI 309 EIAGNLNISREMVRKHEVKALMKLKHP RVDYLRR++ Sbjct: 479 EIAGNLNISREMVRKHEVKALMKLKHPARVDYLRRYV 515 >ref|XP_007219010.1| hypothetical protein PRUPE_ppa004259mg [Prunus persica] gi|462415472|gb|EMJ20209.1| hypothetical protein PRUPE_ppa004259mg [Prunus persica] Length = 519 Score = 72.8 bits (177), Expect = 5e-11 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = -3 Query: 419 EIAGNLNISREMVRKHEVKALMKLKHPTRVDYLRRHI 309 EIAGNLNISREMVRKHEVKALMKLKHP RVDYLRR++ Sbjct: 482 EIAGNLNISREMVRKHEVKALMKLKHPARVDYLRRYV 518 >ref|XP_004166500.1| PREDICTED: RNA polymerase sigma factor sigE, chloroplastic/mitochondrial-like [Cucumis sativus] Length = 515 Score = 72.4 bits (176), Expect = 6e-11 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = -3 Query: 419 EIAGNLNISREMVRKHEVKALMKLKHPTRVDYLRRHI 309 EIAGNLNISREMVRKHEVKALMKLKHP RVDYLRR++ Sbjct: 478 EIAGNLNISREMVRKHEVKALMKLKHPARVDYLRRYL 514 >ref|XP_004149458.1| PREDICTED: RNA polymerase sigma factor sigE, chloroplastic/mitochondrial-like [Cucumis sativus] Length = 514 Score = 72.4 bits (176), Expect = 6e-11 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = -3 Query: 419 EIAGNLNISREMVRKHEVKALMKLKHPTRVDYLRRHI 309 EIAGNLNISREMVRKHEVKALMKLKHP RVDYLRR++ Sbjct: 477 EIAGNLNISREMVRKHEVKALMKLKHPARVDYLRRYL 513 >gb|EYU25198.1| hypothetical protein MIMGU_mgv1a004656mg [Mimulus guttatus] Length = 516 Score = 72.0 bits (175), Expect = 8e-11 Identities = 34/37 (91%), Positives = 34/37 (91%) Frame = -3 Query: 419 EIAGNLNISREMVRKHEVKALMKLKHPTRVDYLRRHI 309 EIAGNLNISREMVRKHEVKA MKLKHP RVDYLR HI Sbjct: 478 EIAGNLNISREMVRKHEVKAFMKLKHPARVDYLRHHI 514 >gb|EXB72455.1| RNA polymerase sigma factor rpoD [Morus notabilis] Length = 517 Score = 72.0 bits (175), Expect = 8e-11 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = -3 Query: 419 EIAGNLNISREMVRKHEVKALMKLKHPTRVDYLRRHI 309 EIAGNLNISREMVRKHEVKALMKLKHP RVDYLRR++ Sbjct: 480 EIAGNLNISREMVRKHEVKALMKLKHPARVDYLRRYM 516 >ref|XP_002268709.1| PREDICTED: RNA polymerase sigma factor rpoD [Vitis vinifera] gi|302143685|emb|CBI22546.3| unnamed protein product [Vitis vinifera] Length = 518 Score = 72.0 bits (175), Expect = 8e-11 Identities = 34/38 (89%), Positives = 37/38 (97%) Frame = -3 Query: 419 EIAGNLNISREMVRKHEVKALMKLKHPTRVDYLRRHIF 306 EIAGNL+ISREMVRKHEVKALMKLKHP RVDYLR++IF Sbjct: 481 EIAGNLSISREMVRKHEVKALMKLKHPARVDYLRQYIF 518 >ref|XP_007161346.1| hypothetical protein PHAVU_001G061400g [Phaseolus vulgaris] gi|561034810|gb|ESW33340.1| hypothetical protein PHAVU_001G061400g [Phaseolus vulgaris] Length = 511 Score = 71.6 bits (174), Expect = 1e-10 Identities = 33/37 (89%), Positives = 36/37 (97%) Frame = -3 Query: 419 EIAGNLNISREMVRKHEVKALMKLKHPTRVDYLRRHI 309 EIAGNLNISREMVRKHEVKALMKLKHP R+DYLRR++ Sbjct: 474 EIAGNLNISREMVRKHEVKALMKLKHPARLDYLRRYV 510 >ref|NP_001254001.1| RNA polymerase sigma factor rpoD-like [Glycine max] gi|382365028|dbj|BAM05477.1| sigma-like factor 5A [Glycine max] Length = 512 Score = 71.6 bits (174), Expect = 1e-10 Identities = 33/37 (89%), Positives = 36/37 (97%) Frame = -3 Query: 419 EIAGNLNISREMVRKHEVKALMKLKHPTRVDYLRRHI 309 EIAGNLNISREMVRKHEVKALMKLKHP R+DYLRR++ Sbjct: 475 EIAGNLNISREMVRKHEVKALMKLKHPARLDYLRRYV 511 >ref|XP_002513587.1| RNA polymerase sigma factor rpoD, putative [Ricinus communis] gi|223547495|gb|EEF48990.1| RNA polymerase sigma factor rpoD, putative [Ricinus communis] Length = 501 Score = 70.5 bits (171), Expect = 2e-10 Identities = 33/37 (89%), Positives = 36/37 (97%) Frame = -3 Query: 419 EIAGNLNISREMVRKHEVKALMKLKHPTRVDYLRRHI 309 EIAGNLNISREMVRK+EVKALMKLKHP RVDYLRR++ Sbjct: 464 EIAGNLNISREMVRKYEVKALMKLKHPARVDYLRRYV 500 >ref|XP_006593758.1| PREDICTED: RNA polymerase sigma factor sigE, chloroplastic/mitochondrial-like isoform X3 [Glycine max] Length = 488 Score = 70.1 bits (170), Expect = 3e-10 Identities = 32/37 (86%), Positives = 36/37 (97%) Frame = -3 Query: 419 EIAGNLNISREMVRKHEVKALMKLKHPTRVDYLRRHI 309 EIAGNLNISRE+VRKHEVKALMKLKHP R+DYLRR++ Sbjct: 451 EIAGNLNISREIVRKHEVKALMKLKHPARLDYLRRYV 487 >ref|XP_006374135.1| hypothetical protein POPTR_0015s02320g [Populus trichocarpa] gi|550321807|gb|ERP51932.1| hypothetical protein POPTR_0015s02320g [Populus trichocarpa] Length = 196 Score = 70.1 bits (170), Expect = 3e-10 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = -3 Query: 419 EIAGNLNISREMVRKHEVKALMKLKHPTRVDYLRRHI 309 EIAGNLNISREMVRKHE KALMKLKHPTRVDYL R++ Sbjct: 159 EIAGNLNISREMVRKHEAKALMKLKHPTRVDYLCRYV 195