BLASTX nr result
ID: Papaver27_contig00025296
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00025296 (1136 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006465753.1| PREDICTED: trihelix transcription factor GTL... 60 2e-06 ref|XP_006432436.1| hypothetical protein CICLE_v10001759mg [Citr... 60 2e-06 ref|XP_002513038.1| conserved hypothetical protein [Ricinus comm... 58 8e-06 >ref|XP_006465753.1| PREDICTED: trihelix transcription factor GTL1-like [Citrus sinensis] Length = 339 Score = 60.1 bits (144), Expect = 2e-06 Identities = 28/39 (71%), Positives = 34/39 (87%) Frame = -2 Query: 118 GQGWEVAESITWLAEVVM*SEEARIDTMKEGEKMRMEAE 2 G+ WE+AESI WLAEVV+ SE+AR+DTM+E EKMR EAE Sbjct: 259 GEDWEIAESIRWLAEVVVRSEQARMDTMREIEKMRTEAE 297 >ref|XP_006432436.1| hypothetical protein CICLE_v10001759mg [Citrus clementina] gi|557534558|gb|ESR45676.1| hypothetical protein CICLE_v10001759mg [Citrus clementina] Length = 337 Score = 60.1 bits (144), Expect = 2e-06 Identities = 28/39 (71%), Positives = 34/39 (87%) Frame = -2 Query: 118 GQGWEVAESITWLAEVVM*SEEARIDTMKEGEKMRMEAE 2 G+ WE+AESI WLAEVV+ SE+AR+DTM+E EKMR EAE Sbjct: 257 GEDWEIAESIRWLAEVVVRSEQARMDTMREIEKMRTEAE 295 >ref|XP_002513038.1| conserved hypothetical protein [Ricinus communis] gi|223548049|gb|EEF49541.1| conserved hypothetical protein [Ricinus communis] Length = 349 Score = 57.8 bits (138), Expect = 8e-06 Identities = 27/41 (65%), Positives = 35/41 (85%) Frame = -2 Query: 124 RGGQGWEVAESITWLAEVVM*SEEARIDTMKEGEKMRMEAE 2 R + WE+A+SI WLAEVV+ SE+AR++TM+E EKMRMEAE Sbjct: 267 RRREEWEIADSIRWLAEVVVRSEQARMETMREVEKMRMEAE 307