BLASTX nr result
ID: Papaver27_contig00024919
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00024919 (472 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004140655.1| PREDICTED: 40S ribosomal protein S27-2-like ... 55 8e-06 ref|XP_002304634.2| hypothetical protein POPTR_0003s15960g, part... 55 1e-05 >ref|XP_004140655.1| PREDICTED: 40S ribosomal protein S27-2-like [Cucumis sativus] gi|449487447|ref|XP_004157631.1| PREDICTED: 40S ribosomal protein S27-2-like [Cucumis sativus] Length = 161 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/36 (72%), Positives = 29/36 (80%) Frame = +1 Query: 364 SVKLIEKVLSNDIDLMNPSAELEKRSHKIKRLVQSP 471 SV +VL NDIDL+NP AELEKR HK+KRLVQSP Sbjct: 70 SVSSFNQVLQNDIDLLNPPAELEKRKHKLKRLVQSP 105 >ref|XP_002304634.2| hypothetical protein POPTR_0003s15960g, partial [Populus trichocarpa] gi|550343279|gb|EEE79613.2| hypothetical protein POPTR_0003s15960g, partial [Populus trichocarpa] Length = 125 Score = 55.1 bits (131), Expect = 1e-05 Identities = 26/35 (74%), Positives = 29/35 (82%) Frame = +1 Query: 367 VKLIEKVLSNDIDLMNPSAELEKRSHKIKRLVQSP 471 V I+ VL NDIDL+NP AELEKR HK+KRLVQSP Sbjct: 35 VSRIKMVLQNDIDLLNPPAELEKRKHKLKRLVQSP 69