BLASTX nr result
ID: Papaver27_contig00024493
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00024493 (375 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002316397.2| hypothetical protein POPTR_0010s23500g [Popu... 57 2e-06 >ref|XP_002316397.2| hypothetical protein POPTR_0010s23500g [Populus trichocarpa] gi|550330446|gb|EEF02568.2| hypothetical protein POPTR_0010s23500g [Populus trichocarpa] Length = 1067 Score = 57.4 bits (137), Expect = 2e-06 Identities = 31/83 (37%), Positives = 49/83 (59%) Frame = +1 Query: 1 RIEEIVDSRLLSELGEVHNDDETISYDVSANERRNIARDKMRQTLTSIIQIGVKCSSKLP 180 R+ ++VDS LL E+ E +D DV A+ K Q LTSII +G+ CS+ LP Sbjct: 973 RVVDVVDSILLREVEETSSDAPRRKQDVRAH--------KNFQCLTSIINVGLACSADLP 1024 Query: 181 SDRINMSKAILDVQAVKNLFLGG 249 +R+ MS + ++ ++++FLGG Sbjct: 1025 KERMAMSTVVAELHRIRDIFLGG 1047