BLASTX nr result
ID: Papaver27_contig00024119
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00024119 (457 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006352247.1| PREDICTED: uncharacterized protein LOC102584... 59 9e-07 >ref|XP_006352247.1| PREDICTED: uncharacterized protein LOC102584958 [Solanum tuberosum] Length = 82 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/47 (57%), Positives = 34/47 (72%) Frame = +2 Query: 2 PKPVEAPKTLFSMSSTNSSVGGKVSEQPKRTPITDKEMEAILLGGII 142 P E P+T FS S + SV GK S+QPKRTP+T +E+E+ILLGG I Sbjct: 36 PAAEETPRTFFSRSPPSMSVAGKASDQPKRTPVTQEEIESILLGGCI 82