BLASTX nr result
ID: Papaver27_contig00022613
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00022613 (1094 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007156173.1| hypothetical protein PHAVU_003G264400g [Phas... 62 4e-07 ref|XP_003520192.1| PREDICTED: lysosomal alpha-mannosidase-like ... 58 6e-06 >ref|XP_007156173.1| hypothetical protein PHAVU_003G264400g [Phaseolus vulgaris] gi|561029527|gb|ESW28167.1| hypothetical protein PHAVU_003G264400g [Phaseolus vulgaris] Length = 1012 Score = 62.0 bits (149), Expect = 4e-07 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = -3 Query: 276 GTLVHEVHRQFSSWVYQVTILYKDKDHVEVEFSM 175 G LVHEVH++FSSW+YQVT LYKDKDH EVEF++ Sbjct: 680 GPLVHEVHQKFSSWIYQVTRLYKDKDHAEVEFTI 713 >ref|XP_003520192.1| PREDICTED: lysosomal alpha-mannosidase-like isoform 1 [Glycine max] Length = 1012 Score = 58.2 bits (139), Expect = 6e-06 Identities = 24/34 (70%), Positives = 30/34 (88%) Frame = -3 Query: 276 GTLVHEVHRQFSSWVYQVTILYKDKDHVEVEFSM 175 G LV EVH++FSSW+YQVT LYKDKDH E+EF++ Sbjct: 680 GPLVDEVHQKFSSWIYQVTRLYKDKDHAEIEFTI 713