BLASTX nr result
ID: Papaver27_contig00022569
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00022569 (475 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004138931.1| PREDICTED: uncharacterized protein LOC101207... 62 8e-08 ref|XP_002530268.1| conserved hypothetical protein [Ricinus comm... 60 3e-07 ref|XP_004307153.1| PREDICTED: uncharacterized protein LOC101295... 59 7e-07 gb|EYU25744.1| hypothetical protein MIMGU_mgv1a017159mg [Mimulus... 57 3e-06 ref|XP_007218655.1| hypothetical protein PRUPE_ppa014023mg [Prun... 57 3e-06 ref|XP_003632314.1| PREDICTED: uncharacterized protein LOC100852... 56 6e-06 ref|XP_006443233.1| hypothetical protein CICLE_v10023972mg [Citr... 55 1e-05 >ref|XP_004138931.1| PREDICTED: uncharacterized protein LOC101207229 [Cucumis sativus] gi|449527448|ref|XP_004170723.1| PREDICTED: uncharacterized LOC101207229 [Cucumis sativus] Length = 90 Score = 62.0 bits (149), Expect = 8e-08 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +3 Query: 3 AEEESLHNIEDLIDTGEYALSLLRKGEIPKYIQ 101 +EE SLHNIEDLIDT EY+LSLLRKGEIPKYIQ Sbjct: 58 SEERSLHNIEDLIDTAEYSLSLLRKGEIPKYIQ 90 >ref|XP_002530268.1| conserved hypothetical protein [Ricinus communis] gi|223530200|gb|EEF32108.1| conserved hypothetical protein [Ricinus communis] Length = 90 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +3 Query: 3 AEEESLHNIEDLIDTGEYALSLLRKGEIPKYIQ 101 +EE SLHNI+DLIDT EYALSLLRKGEIPK+IQ Sbjct: 58 SEERSLHNIDDLIDTAEYALSLLRKGEIPKHIQ 90 >ref|XP_004307153.1| PREDICTED: uncharacterized protein LOC101295655 [Fragaria vesca subsp. vesca] Length = 89 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = +3 Query: 3 AEEESLHNIEDLIDTGEYALSLLRKGEIPKYIQ 101 +EE SLHNIEDLID +Y+LSLLRKGEIPKYIQ Sbjct: 57 SEERSLHNIEDLIDAADYSLSLLRKGEIPKYIQ 89 >gb|EYU25744.1| hypothetical protein MIMGU_mgv1a017159mg [Mimulus guttatus] gi|604311751|gb|EYU25745.1| hypothetical protein MIMGU_mgv1a017159mg [Mimulus guttatus] Length = 90 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = +3 Query: 3 AEEESLHNIEDLIDTGEYALSLLRKGEIPKYIQ 101 AEE S+HNI+DL DT +YALS+L KGEIPKYIQ Sbjct: 58 AEERSIHNIQDLFDTADYALSILNKGEIPKYIQ 90 >ref|XP_007218655.1| hypothetical protein PRUPE_ppa014023mg [Prunus persica] gi|462415117|gb|EMJ19854.1| hypothetical protein PRUPE_ppa014023mg [Prunus persica] Length = 90 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +3 Query: 3 AEEESLHNIEDLIDTGEYALSLLRKGEIPKYIQ 101 +EE SLHNI+DLID Y+LSLLRKGEIPKYIQ Sbjct: 58 SEERSLHNIDDLIDAAHYSLSLLRKGEIPKYIQ 90 >ref|XP_003632314.1| PREDICTED: uncharacterized protein LOC100852488 [Vitis vinifera] gi|296085220|emb|CBI28715.3| unnamed protein product [Vitis vinifera] Length = 90 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = +3 Query: 3 AEEESLHNIEDLIDTGEYALSLLRKGEIPKYIQ 101 AEE SLHNI DLIDT Y+LSLLR G+IPKYIQ Sbjct: 58 AEERSLHNIADLIDTAHYSLSLLRNGQIPKYIQ 90 >ref|XP_006443233.1| hypothetical protein CICLE_v10023972mg [Citrus clementina] gi|568850473|ref|XP_006478937.1| PREDICTED: uncharacterized protein LOC102618712 [Citrus sinensis] gi|557545495|gb|ESR56473.1| hypothetical protein CICLE_v10023972mg [Citrus clementina] Length = 88 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/33 (72%), Positives = 31/33 (93%) Frame = +3 Query: 3 AEEESLHNIEDLIDTGEYALSLLRKGEIPKYIQ 101 +EE S+HNI+DLIDT EYALSLL++G+IPK+IQ Sbjct: 56 SEERSIHNIQDLIDTAEYALSLLKEGKIPKHIQ 88