BLASTX nr result
ID: Papaver27_contig00022270
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00022270 (370 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007050467.1| ATPase E1-E2 type family protein / haloacid ... 56 5e-06 >ref|XP_007050467.1| ATPase E1-E2 type family protein / haloacid dehalogenase-like hydrolase family protein [Theobroma cacao] gi|508702728|gb|EOX94624.1| ATPase E1-E2 type family protein / haloacid dehalogenase-like hydrolase family protein [Theobroma cacao] Length = 1066 Score = 56.2 bits (134), Expect = 5e-06 Identities = 31/61 (50%), Positives = 45/61 (73%), Gaps = 8/61 (13%) Frame = -2 Query: 165 NNYVEHLLNIHTAS--KPLNRWRIAFAAIYSSRVLVSLAKEIIAKRKNQ------YLNPD 10 ++Y LLN+ T+S K RWRIA+AAIYS RV++SLAK+II+KR++Q +L+PD Sbjct: 10 SDYSTLLLNVTTSSLTKAQRRWRIAYAAIYSFRVMLSLAKDIISKRRSQHSSVFSHLHPD 69 Query: 9 I 7 + Sbjct: 70 V 70