BLASTX nr result
ID: Papaver27_contig00022035
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00022035 (1105 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007149518.1| hypothetical protein PHAVU_005G076900g [Phas... 60 2e-06 ref|XP_004302328.1| PREDICTED: anaphase-promoting complex subuni... 58 8e-06 >ref|XP_007149518.1| hypothetical protein PHAVU_005G076900g [Phaseolus vulgaris] gi|561022782|gb|ESW21512.1| hypothetical protein PHAVU_005G076900g [Phaseolus vulgaris] Length = 116 Score = 59.7 bits (143), Expect = 2e-06 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = -3 Query: 119 FSLDFLLDAIWH*L*TEWHGVASWTWDAQDETCGICRMA 3 F L +L + W + WHGVASWTWDAQDETCGICRMA Sbjct: 23 FCLVYLSNISWLMVWPIWHGVASWTWDAQDETCGICRMA 61 >ref|XP_004302328.1| PREDICTED: anaphase-promoting complex subunit 11-like isoform 1 [Fragaria vesca subsp. vesca] Length = 110 Score = 57.8 bits (138), Expect = 8e-06 Identities = 22/24 (91%), Positives = 23/24 (95%) Frame = -3 Query: 74 TEWHGVASWTWDAQDETCGICRMA 3 TEWH VA+WTWDAQDETCGICRMA Sbjct: 32 TEWHAVAAWTWDAQDETCGICRMA 55