BLASTX nr result
ID: Papaver27_contig00021250
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00021250 (586 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI24059.3| unnamed protein product [Vitis vinifera] 57 4e-06 ref|XP_002266489.1| PREDICTED: biotin carboxylase 1, chloroplast... 57 4e-06 gb|AGH32911.1| biotin carboxylase [Camellia chekiangoleosa] 57 5e-06 gb|AFE88229.1| acetyl-CoA carboxylase [Nicotiana tabacum] 57 5e-06 gb|ADI79337.1| chloroplast biotin carboxylase [Brassica rapa] 57 5e-06 gb|ADI79336.1| chloroplast biotin carboxylase [Brassica rapa] 57 5e-06 gb|ADI79334.1| chloroplast biotin carboxylase [Brassica napus] 57 5e-06 gb|ADI79333.1| chloroplast biotin carboxylase [Brassica napus] 57 5e-06 gb|ADI79332.1| chloroplast biotin carboxylase [Brassica napus] 57 5e-06 gb|ADI79331.1| chloroplast biotin carboxylase [Brassica oleracea] 57 5e-06 gb|ADI79330.1| chloroplast biotin carboxylase [Brassica oleracea] 57 5e-06 ref|XP_001755566.1| predicted protein [Physcomitrella patens] gi... 57 5e-06 gb|AAK60339.1| biotin carboxylase [Brassica napus] 57 5e-06 ref|XP_007014554.1| Biotin carboxylase 1, chloroplastic isoform ... 56 8e-06 ref|XP_007014553.1| Biotin carboxylase 1, chloroplastic isoform ... 56 8e-06 ref|XP_007014552.1| Biotin carboxylase 1, chloroplastic isoform ... 56 8e-06 ref|XP_007014551.1| Biotin carboxylase 1, chloroplastic isoform ... 56 8e-06 gb|AGB07440.1| biotin carboxylase [Persea americana] 56 8e-06 ref|NP_001031968.1| biotin carboxylase subunit CAC2 [Arabidopsis... 56 8e-06 ref|NP_198386.1| biotin carboxylase subunit CAC2 [Arabidopsis th... 56 8e-06 >emb|CBI24059.3| unnamed protein product [Vitis vinifera] Length = 587 Score = 57.0 bits (136), Expect = 4e-06 Identities = 33/53 (62%), Positives = 36/53 (67%) Frame = -2 Query: 177 PPVKMDSHVYQD*VVPKAISL*LLTRKTIVSAPTRERAIEHMNRTLSSTVITG 19 P V+MDSHVY D VVP + L K IV APTRERAIE M R L+ TVITG Sbjct: 491 PFVRMDSHVYPDYVVPPSYDS--LLGKLIVWAPTRERAIERMKRALNDTVITG 541 >ref|XP_002266489.1| PREDICTED: biotin carboxylase 1, chloroplastic-like [Vitis vinifera] Length = 525 Score = 57.0 bits (136), Expect = 4e-06 Identities = 33/53 (62%), Positives = 36/53 (67%) Frame = -2 Query: 177 PPVKMDSHVYQD*VVPKAISL*LLTRKTIVSAPTRERAIEHMNRTLSSTVITG 19 P V+MDSHVY D VVP + L K IV APTRERAIE M R L+ TVITG Sbjct: 429 PFVRMDSHVYPDYVVPPSYDS--LLGKLIVWAPTRERAIERMKRALNDTVITG 479 >gb|AGH32911.1| biotin carboxylase [Camellia chekiangoleosa] Length = 518 Score = 56.6 bits (135), Expect = 5e-06 Identities = 32/53 (60%), Positives = 36/53 (67%) Frame = -2 Query: 177 PPVKMDSHVYQD*VVPKAISL*LLTRKTIVSAPTRERAIEHMNRTLSSTVITG 19 P V+MDSHVY D VVP + L K IV APTRERAIE M R L+ T+ITG Sbjct: 429 PFVRMDSHVYPDYVVPPSYDS--LLGKLIVWAPTRERAIERMKRALNDTIITG 479 >gb|AFE88229.1| acetyl-CoA carboxylase [Nicotiana tabacum] Length = 536 Score = 56.6 bits (135), Expect = 5e-06 Identities = 32/53 (60%), Positives = 36/53 (67%) Frame = -2 Query: 177 PPVKMDSHVYQD*VVPKAISL*LLTRKTIVSAPTRERAIEHMNRTLSSTVITG 19 P V+MDSHVY D VVP + L K IV APTRERAIE M R L+ T+ITG Sbjct: 433 PFVRMDSHVYPDYVVPPSYDS--LLGKLIVWAPTRERAIERMKRALNDTIITG 483 >gb|ADI79337.1| chloroplast biotin carboxylase [Brassica rapa] Length = 535 Score = 56.6 bits (135), Expect = 5e-06 Identities = 32/53 (60%), Positives = 36/53 (67%) Frame = -2 Query: 177 PPVKMDSHVYQD*VVPKAISL*LLTRKTIVSAPTRERAIEHMNRTLSSTVITG 19 P V+MDSHVY D VVP + L K IV APTRERAIE M R L+ T+ITG Sbjct: 434 PFVRMDSHVYPDYVVPPSYDS--LLGKLIVWAPTRERAIERMKRALNDTIITG 484 >gb|ADI79336.1| chloroplast biotin carboxylase [Brassica rapa] Length = 536 Score = 56.6 bits (135), Expect = 5e-06 Identities = 32/53 (60%), Positives = 36/53 (67%) Frame = -2 Query: 177 PPVKMDSHVYQD*VVPKAISL*LLTRKTIVSAPTRERAIEHMNRTLSSTVITG 19 P V+MDSHVY D VVP + L K IV APTRERAIE M R L+ T+ITG Sbjct: 435 PFVRMDSHVYPDYVVPPSYDS--LLGKLIVWAPTRERAIERMKRALNDTIITG 485 >gb|ADI79334.1| chloroplast biotin carboxylase [Brassica napus] Length = 536 Score = 56.6 bits (135), Expect = 5e-06 Identities = 32/53 (60%), Positives = 36/53 (67%) Frame = -2 Query: 177 PPVKMDSHVYQD*VVPKAISL*LLTRKTIVSAPTRERAIEHMNRTLSSTVITG 19 P V+MDSHVY D VVP + L K IV APTRERAIE M R L+ T+ITG Sbjct: 435 PFVRMDSHVYPDYVVPPSYDS--LLGKLIVWAPTRERAIERMKRALNDTIITG 485 >gb|ADI79333.1| chloroplast biotin carboxylase [Brassica napus] Length = 535 Score = 56.6 bits (135), Expect = 5e-06 Identities = 32/53 (60%), Positives = 36/53 (67%) Frame = -2 Query: 177 PPVKMDSHVYQD*VVPKAISL*LLTRKTIVSAPTRERAIEHMNRTLSSTVITG 19 P V+MDSHVY D VVP + L K IV APTRERAIE M R L+ T+ITG Sbjct: 434 PFVRMDSHVYPDYVVPPSYDS--LLGKLIVWAPTRERAIERMKRALNDTIITG 484 >gb|ADI79332.1| chloroplast biotin carboxylase [Brassica napus] Length = 535 Score = 56.6 bits (135), Expect = 5e-06 Identities = 32/53 (60%), Positives = 36/53 (67%) Frame = -2 Query: 177 PPVKMDSHVYQD*VVPKAISL*LLTRKTIVSAPTRERAIEHMNRTLSSTVITG 19 P V+MDSHVY D VVP + L K IV APTRERAIE M R L+ T+ITG Sbjct: 434 PFVRMDSHVYPDYVVPPSYDS--LLGKLIVWAPTRERAIERMKRALNDTIITG 484 >gb|ADI79331.1| chloroplast biotin carboxylase [Brassica oleracea] Length = 535 Score = 56.6 bits (135), Expect = 5e-06 Identities = 32/53 (60%), Positives = 36/53 (67%) Frame = -2 Query: 177 PPVKMDSHVYQD*VVPKAISL*LLTRKTIVSAPTRERAIEHMNRTLSSTVITG 19 P V+MDSHVY D VVP + L K IV APTRERAIE M R L+ T+ITG Sbjct: 434 PFVRMDSHVYPDYVVPPSYDS--LLGKLIVWAPTRERAIERMKRALNDTIITG 484 >gb|ADI79330.1| chloroplast biotin carboxylase [Brassica oleracea] Length = 536 Score = 56.6 bits (135), Expect = 5e-06 Identities = 32/53 (60%), Positives = 36/53 (67%) Frame = -2 Query: 177 PPVKMDSHVYQD*VVPKAISL*LLTRKTIVSAPTRERAIEHMNRTLSSTVITG 19 P V+MDSHVY D VVP + L K IV APTRERAIE M R L+ T+ITG Sbjct: 435 PFVRMDSHVYPDYVVPPSYDS--LLGKLIVWAPTRERAIERMKRALNDTIITG 485 >ref|XP_001755566.1| predicted protein [Physcomitrella patens] gi|162693273|gb|EDQ79626.1| predicted protein [Physcomitrella patens] Length = 497 Score = 56.6 bits (135), Expect = 5e-06 Identities = 34/62 (54%), Positives = 39/62 (62%), Gaps = 4/62 (6%) Frame = -2 Query: 192 ILGSRPP----VKMDSHVYQD*VVPKAISL*LLTRKTIVSAPTRERAIEHMNRTLSSTVI 25 I G PP V+MDSH+Y D VVP + L K IV APTRERAIE M R L+ T+I Sbjct: 398 ITGYLPPGGPFVRMDSHIYTDYVVPPSYDS--LLGKLIVWAPTRERAIERMKRALNDTII 455 Query: 24 TG 19 TG Sbjct: 456 TG 457 >gb|AAK60339.1| biotin carboxylase [Brassica napus] Length = 535 Score = 56.6 bits (135), Expect = 5e-06 Identities = 32/53 (60%), Positives = 36/53 (67%) Frame = -2 Query: 177 PPVKMDSHVYQD*VVPKAISL*LLTRKTIVSAPTRERAIEHMNRTLSSTVITG 19 P V+MDSHVY D VVP + L K IV APTRERAIE M R L+ T+ITG Sbjct: 434 PFVRMDSHVYPDYVVPPSYDS--LLGKLIVWAPTRERAIERMKRALNDTIITG 484 >ref|XP_007014554.1| Biotin carboxylase 1, chloroplastic isoform 4 [Theobroma cacao] gi|508784917|gb|EOY32173.1| Biotin carboxylase 1, chloroplastic isoform 4 [Theobroma cacao] Length = 392 Score = 55.8 bits (133), Expect = 8e-06 Identities = 32/53 (60%), Positives = 35/53 (66%) Frame = -2 Query: 177 PPVKMDSHVYQD*VVPKAISL*LLTRKTIVSAPTRERAIEHMNRTLSSTVITG 19 P V+MDSHVY D VVP + L K IV APTRE+AIE M R L TVITG Sbjct: 288 PFVRMDSHVYSDYVVPPSYDS--LLGKLIVWAPTREKAIERMKRALDDTVITG 338 >ref|XP_007014553.1| Biotin carboxylase 1, chloroplastic isoform 3 [Theobroma cacao] gi|508784916|gb|EOY32172.1| Biotin carboxylase 1, chloroplastic isoform 3 [Theobroma cacao] Length = 535 Score = 55.8 bits (133), Expect = 8e-06 Identities = 32/53 (60%), Positives = 35/53 (66%) Frame = -2 Query: 177 PPVKMDSHVYQD*VVPKAISL*LLTRKTIVSAPTRERAIEHMNRTLSSTVITG 19 P V+MDSHVY D VVP + L K IV APTRE+AIE M R L TVITG Sbjct: 431 PFVRMDSHVYSDYVVPPSYDS--LLGKLIVWAPTREKAIERMKRALDDTVITG 481 >ref|XP_007014552.1| Biotin carboxylase 1, chloroplastic isoform 2 [Theobroma cacao] gi|508784915|gb|EOY32171.1| Biotin carboxylase 1, chloroplastic isoform 2 [Theobroma cacao] Length = 501 Score = 55.8 bits (133), Expect = 8e-06 Identities = 32/53 (60%), Positives = 35/53 (66%) Frame = -2 Query: 177 PPVKMDSHVYQD*VVPKAISL*LLTRKTIVSAPTRERAIEHMNRTLSSTVITG 19 P V+MDSHVY D VVP + L K IV APTRE+AIE M R L TVITG Sbjct: 397 PFVRMDSHVYSDYVVPPSYDS--LLGKLIVWAPTREKAIERMKRALDDTVITG 447 >ref|XP_007014551.1| Biotin carboxylase 1, chloroplastic isoform 1 [Theobroma cacao] gi|508784914|gb|EOY32170.1| Biotin carboxylase 1, chloroplastic isoform 1 [Theobroma cacao] Length = 535 Score = 55.8 bits (133), Expect = 8e-06 Identities = 32/53 (60%), Positives = 35/53 (66%) Frame = -2 Query: 177 PPVKMDSHVYQD*VVPKAISL*LLTRKTIVSAPTRERAIEHMNRTLSSTVITG 19 P V+MDSHVY D VVP + L K IV APTRE+AIE M R L TVITG Sbjct: 431 PFVRMDSHVYSDYVVPPSYDS--LLGKLIVWAPTREKAIERMKRALDDTVITG 481 >gb|AGB07440.1| biotin carboxylase [Persea americana] Length = 527 Score = 55.8 bits (133), Expect = 8e-06 Identities = 32/53 (60%), Positives = 36/53 (67%) Frame = -2 Query: 177 PPVKMDSHVYQD*VVPKAISL*LLTRKTIVSAPTRERAIEHMNRTLSSTVITG 19 P V+MDSHVY D VVP + L K IV APTRE+AIE M R L+ TVITG Sbjct: 423 PFVRMDSHVYPDYVVPPSYDS--LLGKLIVWAPTREKAIERMKRALNDTVITG 473 >ref|NP_001031968.1| biotin carboxylase subunit CAC2 [Arabidopsis thaliana] gi|332006574|gb|AED93957.1| biotin carboxylase subunit CAC2 [Arabidopsis thaliana] Length = 499 Score = 55.8 bits (133), Expect = 8e-06 Identities = 31/53 (58%), Positives = 36/53 (67%) Frame = -2 Query: 177 PPVKMDSHVYQD*VVPKAISL*LLTRKTIVSAPTRERAIEHMNRTLSSTVITG 19 P V+MDSHVY D VVP + L K IV APTRE+AIE M R L+ T+ITG Sbjct: 436 PFVRMDSHVYSDYVVPPSYDS--LLGKLIVWAPTREKAIERMKRALNDTIITG 486 >ref|NP_198386.1| biotin carboxylase subunit CAC2 [Arabidopsis thaliana] gi|75317871|sp|O04983.1|ACCC_ARATH RecName: Full=Biotin carboxylase, chloroplastic; AltName: Full=Acetyl-CoA carboxylase subunit A; Short=ACC; Flags: Precursor gi|1905876|gb|AAC09008.1| biotin carboxylase subunit [Arabidopsis thaliana] gi|1916300|gb|AAC09009.1| heteromeric acetyl-CoA carboxylase biotin carboxylase subunit [Arabidopsis thaliana] gi|3047099|gb|AAC13611.1| Arabidopsis thaliana biotin carboxylase subunit (GB:U90879) [Arabidopsis thaliana] gi|10178099|dbj|BAB11486.1| acetyl-CoA carboxylase, biotin carboxylase [Arabidopsis thaliana] gi|21554097|gb|AAM63178.1| acetyl-CoA carboxylase [Arabidopsis thaliana] gi|23297085|gb|AAN13088.1| acetyl-CoA carboxylase [Arabidopsis thaliana] gi|332006573|gb|AED93956.1| biotin carboxylase subunit CAC2 [Arabidopsis thaliana] Length = 537 Score = 55.8 bits (133), Expect = 8e-06 Identities = 31/53 (58%), Positives = 36/53 (67%) Frame = -2 Query: 177 PPVKMDSHVYQD*VVPKAISL*LLTRKTIVSAPTRERAIEHMNRTLSSTVITG 19 P V+MDSHVY D VVP + L K IV APTRE+AIE M R L+ T+ITG Sbjct: 436 PFVRMDSHVYSDYVVPPSYDS--LLGKLIVWAPTREKAIERMKRALNDTIITG 486