BLASTX nr result
ID: Papaver27_contig00020693
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00020693 (467 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003529000.1| PREDICTED: hexokinase-1-like [Glycine max] 63 4e-08 >ref|XP_003529000.1| PREDICTED: hexokinase-1-like [Glycine max] Length = 498 Score = 63.2 bits (152), Expect = 4e-08 Identities = 39/96 (40%), Positives = 44/96 (45%) Frame = +1 Query: 1 AYMERAHVIPKWHGLLPKSGEMEVILTLFSIIIYYALVF*NIFFISGYWNTHCSSFTLSF 180 AY+E AH IPKW GLLPKSGEM I+ W CS Sbjct: 258 AYVECAHAIPKWQGLLPKSGEM---------------------VINMEWGNFCS------ 290 Query: 181 *MKITDLLERGNFSHLPLTEYDHSLDPESLNVGDQV 288 SHLPLTEYD +LD ESLN G+Q+ Sbjct: 291 -------------SHLPLTEYDQALDAESLNPGEQI 313