BLASTX nr result
ID: Papaver27_contig00020572
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00020572 (672 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006432662.1| hypothetical protein CICLE_v10001468mg [Citr... 57 7e-06 >ref|XP_006432662.1| hypothetical protein CICLE_v10001468mg [Citrus clementina] gi|568834741|ref|XP_006471468.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 13 homolog A-like [Citrus sinensis] gi|557534784|gb|ESR45902.1| hypothetical protein CICLE_v10001468mg [Citrus clementina] Length = 386 Score = 56.6 bits (135), Expect = 7e-06 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -2 Query: 671 QIESLRARLDSWVGKVHEALKSVEAETPDLVAS 573 QI+SLR RLDSW+GKVH AL S+EAETPDLVAS Sbjct: 354 QIKSLRDRLDSWLGKVHTALLSIEAETPDLVAS 386