BLASTX nr result
ID: Papaver27_contig00019379
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00019379 (964 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAD20433.1| putative retroelement pol polyprotein [Arabidopsi... 52 1e-06 >gb|AAD20433.1| putative retroelement pol polyprotein [Arabidopsis thaliana] Length = 889 Score = 51.6 bits (122), Expect(2) = 1e-06 Identities = 24/65 (36%), Positives = 38/65 (58%) Frame = -1 Query: 637 MRIITRFITVDTPSPYNAIMRIYWVHRLNGVASTYHQHL*LPAPEGER*IKSDQASSKEC 458 +R +T F+ VD +P+NAI+ W+H + V STYHQ + P+ +G + Q SS++C Sbjct: 135 VRQLTNFLVVDKKAPFNAILGRPWLHVMKAVPSTYHQCIKFPSYKGIAVVYGSQRSSRKC 194 Query: 457 SATKY 443 Y Sbjct: 195 YMGSY 199 Score = 28.5 bits (62), Expect(2) = 1e-06 Identities = 12/22 (54%), Positives = 17/22 (77%) Frame = -2 Query: 789 GSSLNVLFYDAFQKIEFAEDKL 724 GSS++VLFYDAF++ + KL Sbjct: 84 GSSVDVLFYDAFKRTGHLDSKL 105