BLASTX nr result
ID: Papaver27_contig00019225
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00019225 (443 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002515963.1| DNA repair/transcription protein met18/mms19... 54 8e-07 ref|XP_006465694.1| PREDICTED: MMS19 nucleotide excision repair ... 50 3e-06 ref|XP_006465695.1| PREDICTED: MMS19 nucleotide excision repair ... 50 3e-06 >ref|XP_002515963.1| DNA repair/transcription protein met18/mms19, putative [Ricinus communis] gi|223544868|gb|EEF46383.1| DNA repair/transcription protein met18/mms19, putative [Ricinus communis] Length = 1174 Score = 53.9 bits (128), Expect(2) = 8e-07 Identities = 24/39 (61%), Positives = 30/39 (76%) Frame = +2 Query: 116 VRVMKAITSAFDDPKRVVHQEAARCRHAWASLASGSTCY 232 ++V++AI+ A DDPKR V QEA RCR AWAS+AS S Y Sbjct: 1136 IQVLQAISKALDDPKRAVRQEAVRCRQAWASIASRSLHY 1174 Score = 24.6 bits (52), Expect(2) = 8e-07 Identities = 10/13 (76%), Positives = 11/13 (84%) Frame = +1 Query: 4 LPHTRNYPMRPQV 42 LPHTR YP+R QV Sbjct: 1126 LPHTRIYPVRIQV 1138 >ref|XP_006465694.1| PREDICTED: MMS19 nucleotide excision repair protein homolog isoform X1 [Citrus sinensis] Length = 1155 Score = 49.7 bits (117), Expect(2) = 3e-06 Identities = 22/35 (62%), Positives = 27/35 (77%) Frame = +2 Query: 119 RVMKAITSAFDDPKRVVHQEAARCRHAWASLASGS 223 +V++A++ A DDPKR V QEA RCR AWAS AS S Sbjct: 1118 QVLQAVSRALDDPKRAVRQEAVRCRQAWASTASRS 1152 Score = 26.9 bits (58), Expect(2) = 3e-06 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = +1 Query: 1 GLPHTRNYPMRPQV 42 GLPH R YPMR QV Sbjct: 1106 GLPHARIYPMRRQV 1119 >ref|XP_006465695.1| PREDICTED: MMS19 nucleotide excision repair protein homolog isoform X2 [Citrus sinensis] Length = 1151 Score = 49.7 bits (117), Expect(2) = 3e-06 Identities = 22/35 (62%), Positives = 27/35 (77%) Frame = +2 Query: 119 RVMKAITSAFDDPKRVVHQEAARCRHAWASLASGS 223 +V++A++ A DDPKR V QEA RCR AWAS AS S Sbjct: 1114 QVLQAVSRALDDPKRAVRQEAVRCRQAWASTASRS 1148 Score = 26.9 bits (58), Expect(2) = 3e-06 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = +1 Query: 1 GLPHTRNYPMRPQV 42 GLPH R YPMR QV Sbjct: 1102 GLPHARIYPMRRQV 1115