BLASTX nr result
ID: Papaver27_contig00019016
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00019016 (1816 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007219682.1| hypothetical protein PRUPE_ppa025483mg [Prun... 60 4e-06 >ref|XP_007219682.1| hypothetical protein PRUPE_ppa025483mg [Prunus persica] gi|462416144|gb|EMJ20881.1| hypothetical protein PRUPE_ppa025483mg [Prunus persica] Length = 407 Score = 59.7 bits (143), Expect = 4e-06 Identities = 25/55 (45%), Positives = 37/55 (67%) Frame = -2 Query: 165 DDEDPPVKTLREYMYPTRVSQPSCIVFPTTKAHFEIRINTIQALPNFYVRENENP 1 +DE+P V+TL +Y++P R S PSCI+FP +F+ + IQ LP F+ + ENP Sbjct: 21 NDENPLVRTLHDYLHPARTSVPSCIIFPLNGQNFDFKPGMIQLLPTFHEMKYENP 75