BLASTX nr result
ID: Papaver27_contig00017583
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00017583 (649 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU28488.1| hypothetical protein MIMGU_mgv1a000465mg [Mimulus... 57 5e-06 >gb|EYU28488.1| hypothetical protein MIMGU_mgv1a000465mg [Mimulus guttatus] Length = 1133 Score = 57.0 bits (136), Expect = 5e-06 Identities = 25/37 (67%), Positives = 30/37 (81%) Frame = +2 Query: 323 REKSKAAGKMKVWQGYAHAGVVALATWF*WEIVFEVL 433 ++KSK+A KMK WQGYAHAGVVAL+ WF E +FE L Sbjct: 609 KDKSKSASKMKPWQGYAHAGVVALSVWFCRETIFEAL 645