BLASTX nr result
ID: Papaver27_contig00016922
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00016922 (760 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007219207.1| hypothetical protein PRUPE_ppa017292mg [Prun... 42 9e-06 >ref|XP_007219207.1| hypothetical protein PRUPE_ppa017292mg [Prunus persica] gi|462415669|gb|EMJ20406.1| hypothetical protein PRUPE_ppa017292mg [Prunus persica] Length = 925 Score = 41.6 bits (96), Expect(2) = 9e-06 Identities = 26/58 (44%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = -3 Query: 632 NFQLQTEIVLGFCIINEDLLDIHPESGVVGSFGLM-LVSSGKLKLQ-ICNAFREVAQI 465 ++Q + EIVLGF I+N+DL + E G F L+ L+SSGKL+LQ C +F V ++ Sbjct: 502 DWQQKKEIVLGFGIVNKDLSALLSEPDEFGGFTLIRLLSSGKLELQRYCASFDSVQKV 559 Score = 34.7 bits (78), Expect(2) = 9e-06 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = -2 Query: 687 DLSLSGHQCYRGDCRVQEEFS 625 DL LSGH+C+ G C V+EEFS Sbjct: 473 DLLLSGHECHCGSCLVKEEFS 493