BLASTX nr result
ID: Papaver27_contig00016106
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00016106 (505 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006830423.1| hypothetical protein AMTR_s00118p00107060 [A... 59 5e-07 gb|EXB57740.1| E3 ubiquitin-protein ligase [Morus notabilis] 57 2e-06 >ref|XP_006830423.1| hypothetical protein AMTR_s00118p00107060 [Amborella trichopoda] gi|548836757|gb|ERM97839.1| hypothetical protein AMTR_s00118p00107060 [Amborella trichopoda] Length = 446 Score = 59.3 bits (142), Expect = 5e-07 Identities = 31/59 (52%), Positives = 41/59 (69%) Frame = -1 Query: 178 KGGVSVSVVYPFLFLYISFSLMVGTVTSNVLLSGRNFSLSFEDIEANFAPSVKSSGVCG 2 KG V P L + +S L+VG +++V+L G+N SLSF+DIEANF PS+K SGVCG Sbjct: 7 KGDRGEFVYIPLLCIIVS--LVVGMSSASVVLIGQNVSLSFDDIEANFVPSIKGSGVCG 63 >gb|EXB57740.1| E3 ubiquitin-protein ligase [Morus notabilis] Length = 445 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/52 (53%), Positives = 38/52 (73%) Frame = -1 Query: 157 VVYPFLFLYISFSLMVGTVTSNVLLSGRNFSLSFEDIEANFAPSVKSSGVCG 2 VV+ +FL FSL +++NV+L G N +LSF+DIEANFAP++K SG CG Sbjct: 5 VVFSVMFLLSGFSL----ISANVVLIGNNVTLSFDDIEANFAPAIKGSGECG 52