BLASTX nr result
ID: Papaver27_contig00013337
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00013337 (463 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002461853.1| hypothetical protein SORBIDRAFT_02g009270 [S... 84 2e-14 ref|XP_006382981.1| hypothetical protein POPTR_0005s10230g [Popu... 84 3e-14 ref|XP_006382980.1| hypothetical protein POPTR_0005s10230g [Popu... 84 3e-14 ref|XP_002306421.2| auxin efflux carrier family protein [Populus... 84 3e-14 ref|XP_006382976.1| hypothetical protein POPTR_0005s10230g [Popu... 84 3e-14 ref|XP_006409300.1| hypothetical protein EUTSA_v10022717mg [Eutr... 83 3e-14 dbj|BAG92093.1| unnamed protein product [Oryza sativa Japonica G... 83 3e-14 ref|NP_001063887.1| Os09g0554300 [Oryza sativa Japonica Group] g... 83 3e-14 gb|EMT16972.1| Putative transporter [Aegilops tauschii] 83 5e-14 gb|EMS54288.1| Uncharacterized transporter C5D6.04 [Triticum ura... 83 5e-14 dbj|BAJ99434.1| predicted protein [Hordeum vulgare subsp. vulgare] 83 5e-14 dbj|BAK01989.1| predicted protein [Hordeum vulgare subsp. vulgare] 83 5e-14 ref|XP_002866780.1| predicted protein [Arabidopsis lyrata subsp.... 83 5e-14 ref|XP_002521739.1| auxin:hydrogen symporter, putative [Ricinus ... 83 5e-14 ref|XP_006393787.1| hypothetical protein EUTSA_v10005581mg [Eutr... 82 6e-14 ref|NP_201399.1| auxin efflux carrier family protein [Arabidopsi... 82 6e-14 gb|AFK32350.1| putative auxin efflux carrier-like protein PINX [... 82 6e-14 ref|NP_001147841.1| auxin Efflux Carrier family protein [Zea may... 82 6e-14 ref|XP_006660956.1| PREDICTED: uncharacterized transporter YBR28... 82 1e-13 ref|XP_006388075.1| hypothetical protein POPTR_0365s00230g [Popu... 82 1e-13 >ref|XP_002461853.1| hypothetical protein SORBIDRAFT_02g009270 [Sorghum bicolor] gi|241925230|gb|EER98374.1| hypothetical protein SORBIDRAFT_02g009270 [Sorghum bicolor] Length = 94 Score = 84.3 bits (207), Expect = 2e-14 Identities = 35/46 (76%), Positives = 46/46 (100%) Frame = -2 Query: 462 PPAMNVGTIAQLFDVGQDECSIILLWTYLVAALALTIWSTIFLYLL 325 PPAM++GT++QL+DVGQ+ECS+ILLWTYLVAALALT+WSTIF+++L Sbjct: 48 PPAMSIGTMSQLYDVGQEECSVILLWTYLVAALALTVWSTIFMWIL 93 >ref|XP_006382981.1| hypothetical protein POPTR_0005s10230g [Populus trichocarpa] gi|550338536|gb|ERP60778.1| hypothetical protein POPTR_0005s10230g [Populus trichocarpa] Length = 370 Score = 83.6 bits (205), Expect = 3e-14 Identities = 35/47 (74%), Positives = 44/47 (93%) Frame = -2 Query: 462 PPAMNVGTIAQLFDVGQDECSIILLWTYLVAALALTIWSTIFLYLLA 322 PPAMN+GT+ QLFDVGQ+ECS++ LWTYLVAALALT WSTIF+++L+ Sbjct: 324 PPAMNIGTMTQLFDVGQEECSVLFLWTYLVAALALTAWSTIFMWILS 370 >ref|XP_006382980.1| hypothetical protein POPTR_0005s10230g [Populus trichocarpa] gi|550338535|gb|ERP60777.1| hypothetical protein POPTR_0005s10230g [Populus trichocarpa] Length = 266 Score = 83.6 bits (205), Expect = 3e-14 Identities = 35/47 (74%), Positives = 44/47 (93%) Frame = -2 Query: 462 PPAMNVGTIAQLFDVGQDECSIILLWTYLVAALALTIWSTIFLYLLA 322 PPAMN+GT+ QLFDVGQ+ECS++ LWTYLVAALALT WSTIF+++L+ Sbjct: 220 PPAMNIGTMTQLFDVGQEECSVLFLWTYLVAALALTAWSTIFMWILS 266 >ref|XP_002306421.2| auxin efflux carrier family protein [Populus trichocarpa] gi|566170511|ref|XP_006382977.1| hypothetical protein POPTR_0005s10230g [Populus trichocarpa] gi|566170513|ref|XP_006382978.1| hypothetical protein POPTR_0005s10230g [Populus trichocarpa] gi|566170515|ref|XP_006382979.1| hypothetical protein POPTR_0005s10230g [Populus trichocarpa] gi|550338531|gb|EEE93417.2| auxin efflux carrier family protein [Populus trichocarpa] gi|550338532|gb|ERP60774.1| hypothetical protein POPTR_0005s10230g [Populus trichocarpa] gi|550338533|gb|ERP60775.1| hypothetical protein POPTR_0005s10230g [Populus trichocarpa] gi|550338534|gb|ERP60776.1| hypothetical protein POPTR_0005s10230g [Populus trichocarpa] Length = 418 Score = 83.6 bits (205), Expect = 3e-14 Identities = 35/47 (74%), Positives = 44/47 (93%) Frame = -2 Query: 462 PPAMNVGTIAQLFDVGQDECSIILLWTYLVAALALTIWSTIFLYLLA 322 PPAMN+GT+ QLFDVGQ+ECS++ LWTYLVAALALT WSTIF+++L+ Sbjct: 372 PPAMNIGTMTQLFDVGQEECSVLFLWTYLVAALALTAWSTIFMWILS 418 >ref|XP_006382976.1| hypothetical protein POPTR_0005s10230g [Populus trichocarpa] gi|566170521|ref|XP_006382982.1| hypothetical protein POPTR_0005s10230g [Populus trichocarpa] gi|550338530|gb|ERP60773.1| hypothetical protein POPTR_0005s10230g [Populus trichocarpa] gi|550338537|gb|ERP60779.1| hypothetical protein POPTR_0005s10230g [Populus trichocarpa] Length = 344 Score = 83.6 bits (205), Expect = 3e-14 Identities = 35/47 (74%), Positives = 44/47 (93%) Frame = -2 Query: 462 PPAMNVGTIAQLFDVGQDECSIILLWTYLVAALALTIWSTIFLYLLA 322 PPAMN+GT+ QLFDVGQ+ECS++ LWTYLVAALALT WSTIF+++L+ Sbjct: 298 PPAMNIGTMTQLFDVGQEECSVLFLWTYLVAALALTAWSTIFMWILS 344 >ref|XP_006409300.1| hypothetical protein EUTSA_v10022717mg [Eutrema salsugineum] gi|557110462|gb|ESQ50753.1| hypothetical protein EUTSA_v10022717mg [Eutrema salsugineum] Length = 397 Score = 83.2 bits (204), Expect = 3e-14 Identities = 34/46 (73%), Positives = 44/46 (95%) Frame = -2 Query: 462 PPAMNVGTIAQLFDVGQDECSIILLWTYLVAALALTIWSTIFLYLL 325 PPAMN+GT+ QL++VGQDECS+++LWTYL+A LALT+WSTIFL+LL Sbjct: 351 PPAMNIGTMTQLYNVGQDECSVLMLWTYLIAILALTVWSTIFLHLL 396 >dbj|BAG92093.1| unnamed protein product [Oryza sativa Japonica Group] Length = 373 Score = 83.2 bits (204), Expect = 3e-14 Identities = 35/47 (74%), Positives = 44/47 (93%) Frame = -2 Query: 462 PPAMNVGTIAQLFDVGQDECSIILLWTYLVAALALTIWSTIFLYLLA 322 PPAMN+GT+AQLFDVGQ+ECS+I LWTYL+AA+ALT WSTIF+ +L+ Sbjct: 327 PPAMNIGTMAQLFDVGQEECSVIFLWTYLIAAIALTTWSTIFMSILS 373 >ref|NP_001063887.1| Os09g0554300 [Oryza sativa Japonica Group] gi|113632120|dbj|BAF25801.1| Os09g0554300 [Oryza sativa Japonica Group] gi|218202602|gb|EEC85029.1| hypothetical protein OsI_32333 [Oryza sativa Indica Group] gi|222642062|gb|EEE70194.1| hypothetical protein OsJ_30279 [Oryza sativa Japonica Group] Length = 428 Score = 83.2 bits (204), Expect = 3e-14 Identities = 35/47 (74%), Positives = 44/47 (93%) Frame = -2 Query: 462 PPAMNVGTIAQLFDVGQDECSIILLWTYLVAALALTIWSTIFLYLLA 322 PPAMN+GT+AQLFDVGQ+ECS+I LWTYL+AA+ALT WSTIF+ +L+ Sbjct: 382 PPAMNIGTMAQLFDVGQEECSVIFLWTYLIAAIALTTWSTIFMSILS 428 >gb|EMT16972.1| Putative transporter [Aegilops tauschii] Length = 428 Score = 82.8 bits (203), Expect = 5e-14 Identities = 35/47 (74%), Positives = 44/47 (93%) Frame = -2 Query: 462 PPAMNVGTIAQLFDVGQDECSIILLWTYLVAALALTIWSTIFLYLLA 322 PPAMN+GT+AQLFDVGQ+ECS+I LWTYLVAA+ALT WST+F+ +L+ Sbjct: 382 PPAMNIGTMAQLFDVGQEECSVIFLWTYLVAAVALTTWSTVFMSILS 428 >gb|EMS54288.1| Uncharacterized transporter C5D6.04 [Triticum urartu] Length = 440 Score = 82.8 bits (203), Expect = 5e-14 Identities = 35/47 (74%), Positives = 44/47 (93%) Frame = -2 Query: 462 PPAMNVGTIAQLFDVGQDECSIILLWTYLVAALALTIWSTIFLYLLA 322 PPAMN+GT+AQLFDVGQ+ECS+I LWTYLVAA+ALT WST+F+ +L+ Sbjct: 394 PPAMNIGTMAQLFDVGQEECSVIFLWTYLVAAVALTTWSTVFMSILS 440 >dbj|BAJ99434.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 377 Score = 82.8 bits (203), Expect = 5e-14 Identities = 35/47 (74%), Positives = 44/47 (93%) Frame = -2 Query: 462 PPAMNVGTIAQLFDVGQDECSIILLWTYLVAALALTIWSTIFLYLLA 322 PPAMN+GT+AQLFDVGQ+ECS+I LWTYLVAA+ALT WST+F+ +L+ Sbjct: 331 PPAMNIGTMAQLFDVGQEECSVIFLWTYLVAAVALTTWSTVFMSILS 377 >dbj|BAK01989.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 416 Score = 82.8 bits (203), Expect = 5e-14 Identities = 35/47 (74%), Positives = 44/47 (93%) Frame = -2 Query: 462 PPAMNVGTIAQLFDVGQDECSIILLWTYLVAALALTIWSTIFLYLLA 322 PPAMN+GT+AQLFDVGQ+ECS+I LWTYLVAA+ALT WST+F+ +L+ Sbjct: 370 PPAMNIGTMAQLFDVGQEECSVIFLWTYLVAAVALTTWSTVFMSILS 416 >ref|XP_002866780.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297312615|gb|EFH43039.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 395 Score = 82.8 bits (203), Expect = 5e-14 Identities = 37/47 (78%), Positives = 43/47 (91%) Frame = -2 Query: 462 PPAMNVGTIAQLFDVGQDECSIILLWTYLVAALALTIWSTIFLYLLA 322 PPAMN+ T+AQLFDV QDECS+I LWTYLVA+LALTIWSTIFL +L+ Sbjct: 349 PPAMNISTMAQLFDVAQDECSVIFLWTYLVASLALTIWSTIFLSILS 395 >ref|XP_002521739.1| auxin:hydrogen symporter, putative [Ricinus communis] gi|223539130|gb|EEF40726.1| auxin:hydrogen symporter, putative [Ricinus communis] Length = 406 Score = 82.8 bits (203), Expect = 5e-14 Identities = 34/47 (72%), Positives = 44/47 (93%) Frame = -2 Query: 462 PPAMNVGTIAQLFDVGQDECSIILLWTYLVAALALTIWSTIFLYLLA 322 PPAMN+GT+ QLFDVGQ+ECS++ LWTYLVAALALT WSTI++++L+ Sbjct: 360 PPAMNIGTMTQLFDVGQEECSVLFLWTYLVAALALTFWSTIYMWILS 406 >ref|XP_006393787.1| hypothetical protein EUTSA_v10005581mg [Eutrema salsugineum] gi|557090426|gb|ESQ31073.1| hypothetical protein EUTSA_v10005581mg [Eutrema salsugineum] Length = 395 Score = 82.4 bits (202), Expect = 6e-14 Identities = 36/47 (76%), Positives = 43/47 (91%) Frame = -2 Query: 462 PPAMNVGTIAQLFDVGQDECSIILLWTYLVAALALTIWSTIFLYLLA 322 PPAMN+ T+AQLFDV QDECS+I LWTYLVA+LALT+WSTIFL +L+ Sbjct: 349 PPAMNISTMAQLFDVAQDECSVIFLWTYLVASLALTVWSTIFLSILS 395 >ref|NP_201399.1| auxin efflux carrier family protein [Arabidopsis thaliana] gi|10177113|dbj|BAB10403.1| unnamed protein product [Arabidopsis thaliana] gi|332010751|gb|AED98134.1| auxin efflux carrier family protein [Arabidopsis thaliana] Length = 395 Score = 82.4 bits (202), Expect = 6e-14 Identities = 36/47 (76%), Positives = 43/47 (91%) Frame = -2 Query: 462 PPAMNVGTIAQLFDVGQDECSIILLWTYLVAALALTIWSTIFLYLLA 322 PPAMN+ T+AQLFDV QDECS+I LWTYLVA+LALT+WSTIFL +L+ Sbjct: 349 PPAMNISTMAQLFDVAQDECSVIFLWTYLVASLALTVWSTIFLSILS 395 >gb|AFK32350.1| putative auxin efflux carrier-like protein PINX [Zea mays] Length = 428 Score = 82.4 bits (202), Expect = 6e-14 Identities = 35/47 (74%), Positives = 44/47 (93%) Frame = -2 Query: 462 PPAMNVGTIAQLFDVGQDECSIILLWTYLVAALALTIWSTIFLYLLA 322 PPAMN+GT+AQLFDVGQ+ECS+I LWTYLVAA+ALT WST+F+ +L+ Sbjct: 382 PPAMNIGTMAQLFDVGQEECSVIFLWTYLVAAVALTAWSTVFMSVLS 428 >ref|NP_001147841.1| auxin Efflux Carrier family protein [Zea mays] gi|195614088|gb|ACG28874.1| auxin Efflux Carrier family protein [Zea mays] Length = 424 Score = 82.4 bits (202), Expect = 6e-14 Identities = 35/47 (74%), Positives = 44/47 (93%) Frame = -2 Query: 462 PPAMNVGTIAQLFDVGQDECSIILLWTYLVAALALTIWSTIFLYLLA 322 PPAMN+GT+AQLFDVGQ+ECS+I LWTYLVAA+ALT WST+F+ +L+ Sbjct: 378 PPAMNIGTMAQLFDVGQEECSVIFLWTYLVAAVALTAWSTVFMSVLS 424 >ref|XP_006660956.1| PREDICTED: uncharacterized transporter YBR287W-like [Oryza brachyantha] Length = 425 Score = 81.6 bits (200), Expect = 1e-13 Identities = 34/47 (72%), Positives = 44/47 (93%) Frame = -2 Query: 462 PPAMNVGTIAQLFDVGQDECSIILLWTYLVAALALTIWSTIFLYLLA 322 PPAMN+GT+AQLFDVGQ+ECS+I LW+YL+AA+ALT WSTIF+ +L+ Sbjct: 379 PPAMNIGTMAQLFDVGQEECSVIFLWSYLIAAIALTTWSTIFMSILS 425 >ref|XP_006388075.1| hypothetical protein POPTR_0365s00230g [Populus trichocarpa] gi|550309392|gb|ERP46989.1| hypothetical protein POPTR_0365s00230g [Populus trichocarpa] Length = 428 Score = 81.6 bits (200), Expect = 1e-13 Identities = 34/47 (72%), Positives = 44/47 (93%) Frame = -2 Query: 462 PPAMNVGTIAQLFDVGQDECSIILLWTYLVAALALTIWSTIFLYLLA 322 PPAMN+GT+ QLF+VGQ+ECS++ LWTYLVAALALT WSTIF+++L+ Sbjct: 382 PPAMNIGTMTQLFNVGQEECSVLFLWTYLVAALALTAWSTIFMWILS 428