BLASTX nr result
ID: Papaver27_contig00013225
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00013225 (1497 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006392420.1| hypothetical protein EUTSA_v10023228mg [Eutr... 59 7e-06 >ref|XP_006392420.1| hypothetical protein EUTSA_v10023228mg [Eutrema salsugineum] gi|557088926|gb|ESQ29706.1| hypothetical protein EUTSA_v10023228mg [Eutrema salsugineum] Length = 1113 Score = 58.5 bits (140), Expect = 7e-06 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = -1 Query: 237 REIDFVNELVNTLAVNGTEGSDYKGGRKGTTQLI 136 REIDFVNE V TLA NGT+GSDY+GGRKGT+QL+ Sbjct: 710 REIDFVNERVQTLAGNGTKGSDYQGGRKGTSQLL 743