BLASTX nr result
ID: Papaver27_contig00010460
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00010460 (421 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB99574.1| Transcriptional corepressor SEUSS [Morus notabilis] 55 8e-06 >gb|EXB99574.1| Transcriptional corepressor SEUSS [Morus notabilis] Length = 926 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/36 (69%), Positives = 31/36 (86%) Frame = -3 Query: 416 MRNLGHVKLEQQQIQNIRGLNPVKMESQHTDQSLFL 309 +RNL VKLE QQ+QN+RGL PVK+E QH+DQSLF+ Sbjct: 220 LRNLSAVKLEPQQLQNMRGLAPVKLEPQHSDQSLFM 255