BLASTX nr result
ID: Papaver27_contig00010176
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00010176 (583 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006849555.1| hypothetical protein AMTR_s00024p00176520 [A... 54 5e-06 >ref|XP_006849555.1| hypothetical protein AMTR_s00024p00176520 [Amborella trichopoda] gi|548853130|gb|ERN11136.1| hypothetical protein AMTR_s00024p00176520 [Amborella trichopoda] Length = 707 Score = 53.5 bits (127), Expect(2) = 5e-06 Identities = 23/33 (69%), Positives = 28/33 (84%) Frame = -1 Query: 325 RVGGSPIYKVDRKLGKGGFQQVFVGCHVSGTKE 227 +VGGSP+YK++RKLGKGGF QVFVG +SG E Sbjct: 134 QVGGSPVYKIERKLGKGGFGQVFVGRRISGGSE 166 Score = 22.7 bits (47), Expect(2) = 5e-06 Identities = 8/21 (38%), Positives = 15/21 (71%) Frame = -2 Query: 219 KSKKFGSVEVVVKFKHKSIGG 157 +S G++EV +KF+H++ G Sbjct: 167 RSSGAGAIEVALKFEHRNSKG 187