BLASTX nr result
ID: Papaver27_contig00008461
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00008461 (528 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007031930.1| Ribosomal protein L7Ae/L30e/S12e/Gadd45 fami... 69 2e-13 ref|XP_002516814.1| structural constituent of ribosome, putative... 69 3e-13 emb|CBI16928.3| unnamed protein product [Vitis vinifera] 69 3e-13 ref|XP_006373409.1| hypothetical protein POPTR_0017s13510g [Popu... 69 3e-13 ref|XP_004304533.1| PREDICTED: 60S ribosomal protein L7a-like [F... 69 3e-13 ref|XP_002525937.1| 60S ribosomal protein L7a, putative [Ricinus... 69 3e-13 ref|XP_006373411.1| 60S ribosomal protein L7a [Populus trichocar... 69 3e-13 gb|ABK94700.1| unknown [Populus trichocarpa] gi|118487037|gb|ABK... 69 3e-13 ref|XP_006384274.1| 60S ribosomal protein L7a [Populus trichocar... 69 3e-13 ref|XP_006384272.1| 60S ribosomal protein L7a [Populus trichocar... 69 3e-13 ref|XP_002281689.1| PREDICTED: 60S ribosomal protein L7a [Vitis ... 69 3e-13 ref|XP_004143647.1| PREDICTED: 60S ribosomal protein L7a-like [C... 68 4e-13 emb|CBI15705.3| unnamed protein product [Vitis vinifera] 67 6e-13 ref|XP_004307051.1| PREDICTED: 60S ribosomal protein L7a-2-like ... 67 6e-13 ref|XP_004240870.1| PREDICTED: 60S ribosomal protein L7a-2-like ... 67 6e-13 gb|ABB87129.1| 60S ribosomal protein L7A-like [Solanum tuberosum] 67 6e-13 gb|AFK39670.1| unknown [Lotus japonicus] 67 6e-13 ref|XP_006356534.1| PREDICTED: 60S ribosomal protein L7a-2-like ... 67 6e-13 ref|XP_004241895.1| PREDICTED: 60S ribosomal protein L7a-2-like ... 67 6e-13 ref|XP_004241894.1| PREDICTED: 60S ribosomal protein L7a-2-like ... 67 6e-13 >ref|XP_007031930.1| Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein [Theobroma cacao] gi|508710959|gb|EOY02856.1| Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein [Theobroma cacao] Length = 259 Score = 68.6 bits (166), Expect(2) = 2e-13 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = +1 Query: 115 IDFIELVVWLPALCRKMEIPYAIVKGKARLGAIVH 219 +D IELVVWLPALCRKMEIPY IVKGKARLGAIVH Sbjct: 154 VDPIELVVWLPALCRKMEIPYCIVKGKARLGAIVH 188 Score = 32.3 bits (72), Expect(2) = 2e-13 Identities = 13/19 (68%), Positives = 18/19 (94%) Frame = +2 Query: 56 THILYQNKAQMVIIAHDVE 112 T+++ QNKAQ+VIIAHDV+ Sbjct: 137 TYLIEQNKAQLVIIAHDVD 155 >ref|XP_002516814.1| structural constituent of ribosome, putative [Ricinus communis] gi|223543902|gb|EEF45428.1| structural constituent of ribosome, putative [Ricinus communis] Length = 631 Score = 68.6 bits (166), Expect(2) = 3e-13 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = +1 Query: 115 IDFIELVVWLPALCRKMEIPYAIVKGKARLGAIVH 219 +D IELVVWLPALCRKME+PYAIVKGK+RLGAIVH Sbjct: 526 VDPIELVVWLPALCRKMEVPYAIVKGKSRLGAIVH 560 Score = 32.0 bits (71), Expect(2) = 3e-13 Identities = 12/19 (63%), Positives = 18/19 (94%) Frame = +2 Query: 56 THILYQNKAQMVIIAHDVE 112 T+++ QNKAQ+V+IAHDV+ Sbjct: 509 TYLIEQNKAQLVVIAHDVD 527 >emb|CBI16928.3| unnamed protein product [Vitis vinifera] Length = 337 Score = 68.6 bits (166), Expect(2) = 3e-13 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = +1 Query: 115 IDFIELVVWLPALCRKMEIPYAIVKGKARLGAIVH 219 +D IELVVWLPALCRKME+PYAIVKGK+RLGAIVH Sbjct: 232 VDPIELVVWLPALCRKMEVPYAIVKGKSRLGAIVH 266 Score = 32.0 bits (71), Expect(2) = 3e-13 Identities = 12/19 (63%), Positives = 18/19 (94%) Frame = +2 Query: 56 THILYQNKAQMVIIAHDVE 112 T+++ QNKAQ+V+IAHDV+ Sbjct: 215 TYLIEQNKAQLVVIAHDVD 233 >ref|XP_006373409.1| hypothetical protein POPTR_0017s13510g [Populus trichocarpa] gi|550320231|gb|ERP51206.1| hypothetical protein POPTR_0017s13510g [Populus trichocarpa] Length = 272 Score = 68.6 bits (166), Expect(2) = 3e-13 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = +1 Query: 115 IDFIELVVWLPALCRKMEIPYAIVKGKARLGAIVH 219 +D IELVVWLPALCRKME+PYAIVKGK+RLGAIVH Sbjct: 167 VDPIELVVWLPALCRKMEVPYAIVKGKSRLGAIVH 201 Score = 32.0 bits (71), Expect(2) = 3e-13 Identities = 12/19 (63%), Positives = 18/19 (94%) Frame = +2 Query: 56 THILYQNKAQMVIIAHDVE 112 T+++ QNKAQ+V+IAHDV+ Sbjct: 150 TYLIEQNKAQLVVIAHDVD 168 >ref|XP_004304533.1| PREDICTED: 60S ribosomal protein L7a-like [Fragaria vesca subsp. vesca] Length = 259 Score = 68.6 bits (166), Expect(2) = 3e-13 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = +1 Query: 115 IDFIELVVWLPALCRKMEIPYAIVKGKARLGAIVH 219 +D IELVVWLPALCRKMEIPY IVKGKARLGAIVH Sbjct: 154 VDPIELVVWLPALCRKMEIPYCIVKGKARLGAIVH 188 Score = 32.0 bits (71), Expect(2) = 3e-13 Identities = 12/19 (63%), Positives = 18/19 (94%) Frame = +2 Query: 56 THILYQNKAQMVIIAHDVE 112 T+++ QNKAQ+V+IAHDV+ Sbjct: 137 TYLIEQNKAQLVVIAHDVD 155 >ref|XP_002525937.1| 60S ribosomal protein L7a, putative [Ricinus communis] gi|223534766|gb|EEF36457.1| 60S ribosomal protein L7a, putative [Ricinus communis] Length = 258 Score = 68.6 bits (166), Expect(2) = 3e-13 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = +1 Query: 115 IDFIELVVWLPALCRKMEIPYAIVKGKARLGAIVH 219 +D IELVVWLPALCRKME+PYAIVKGK+RLGAIVH Sbjct: 153 VDPIELVVWLPALCRKMEVPYAIVKGKSRLGAIVH 187 Score = 32.0 bits (71), Expect(2) = 3e-13 Identities = 12/19 (63%), Positives = 18/19 (94%) Frame = +2 Query: 56 THILYQNKAQMVIIAHDVE 112 T+++ QNKAQ+V+IAHDV+ Sbjct: 136 TYLIEQNKAQLVVIAHDVD 154 >ref|XP_006373411.1| 60S ribosomal protein L7a [Populus trichocarpa] gi|550320233|gb|ERP51208.1| 60S ribosomal protein L7a [Populus trichocarpa] Length = 258 Score = 68.6 bits (166), Expect(2) = 3e-13 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = +1 Query: 115 IDFIELVVWLPALCRKMEIPYAIVKGKARLGAIVH 219 +D IELVVWLPALCRKME+PYAIVKGK+RLGAIVH Sbjct: 153 VDPIELVVWLPALCRKMEVPYAIVKGKSRLGAIVH 187 Score = 32.0 bits (71), Expect(2) = 3e-13 Identities = 12/19 (63%), Positives = 18/19 (94%) Frame = +2 Query: 56 THILYQNKAQMVIIAHDVE 112 T+++ QNKAQ+V+IAHDV+ Sbjct: 136 TYLIEQNKAQLVVIAHDVD 154 >gb|ABK94700.1| unknown [Populus trichocarpa] gi|118487037|gb|ABK95349.1| unknown [Populus trichocarpa] gi|118487654|gb|ABK95652.1| unknown [Populus trichocarpa] Length = 258 Score = 68.6 bits (166), Expect(2) = 3e-13 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = +1 Query: 115 IDFIELVVWLPALCRKMEIPYAIVKGKARLGAIVH 219 +D IELVVWLPALCRKME+PYAIVKGK+RLGAIVH Sbjct: 153 VDPIELVVWLPALCRKMEVPYAIVKGKSRLGAIVH 187 Score = 32.0 bits (71), Expect(2) = 3e-13 Identities = 12/19 (63%), Positives = 18/19 (94%) Frame = +2 Query: 56 THILYQNKAQMVIIAHDVE 112 T+++ QNKAQ+V+IAHDV+ Sbjct: 136 TYLIEQNKAQLVVIAHDVD 154 >ref|XP_006384274.1| 60S ribosomal protein L7a [Populus trichocarpa] gi|118481706|gb|ABK92793.1| unknown [Populus trichocarpa] gi|550340820|gb|ERP62071.1| 60S ribosomal protein L7a [Populus trichocarpa] Length = 258 Score = 68.6 bits (166), Expect(2) = 3e-13 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = +1 Query: 115 IDFIELVVWLPALCRKMEIPYAIVKGKARLGAIVH 219 +D IELVVWLPALCRKME+PYAIVKGK+RLGAIVH Sbjct: 153 VDPIELVVWLPALCRKMEVPYAIVKGKSRLGAIVH 187 Score = 32.0 bits (71), Expect(2) = 3e-13 Identities = 12/19 (63%), Positives = 18/19 (94%) Frame = +2 Query: 56 THILYQNKAQMVIIAHDVE 112 T+++ QNKAQ+V+IAHDV+ Sbjct: 136 TYLIEQNKAQLVVIAHDVD 154 >ref|XP_006384272.1| 60S ribosomal protein L7a [Populus trichocarpa] gi|118482301|gb|ABK93077.1| unknown [Populus trichocarpa] gi|118484138|gb|ABK93952.1| unknown [Populus trichocarpa] gi|118489983|gb|ABK96788.1| unknown [Populus trichocarpa x Populus deltoides] gi|550340818|gb|ERP62069.1| 60S ribosomal protein L7a [Populus trichocarpa] Length = 258 Score = 68.6 bits (166), Expect(2) = 3e-13 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = +1 Query: 115 IDFIELVVWLPALCRKMEIPYAIVKGKARLGAIVH 219 +D IELVVWLPALCRKME+PYAIVKGK+RLGAIVH Sbjct: 153 VDPIELVVWLPALCRKMEVPYAIVKGKSRLGAIVH 187 Score = 32.0 bits (71), Expect(2) = 3e-13 Identities = 12/19 (63%), Positives = 18/19 (94%) Frame = +2 Query: 56 THILYQNKAQMVIIAHDVE 112 T+++ QNKAQ+V+IAHDV+ Sbjct: 136 TYLIEQNKAQLVVIAHDVD 154 >ref|XP_002281689.1| PREDICTED: 60S ribosomal protein L7a [Vitis vinifera] gi|147858681|emb|CAN81023.1| hypothetical protein VITISV_030542 [Vitis vinifera] Length = 258 Score = 68.6 bits (166), Expect(2) = 3e-13 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = +1 Query: 115 IDFIELVVWLPALCRKMEIPYAIVKGKARLGAIVH 219 +D IELVVWLPALCRKME+PYAIVKGK+RLGAIVH Sbjct: 153 VDPIELVVWLPALCRKMEVPYAIVKGKSRLGAIVH 187 Score = 32.0 bits (71), Expect(2) = 3e-13 Identities = 12/19 (63%), Positives = 18/19 (94%) Frame = +2 Query: 56 THILYQNKAQMVIIAHDVE 112 T+++ QNKAQ+V+IAHDV+ Sbjct: 136 TYLIEQNKAQLVVIAHDVD 154 >ref|XP_004143647.1| PREDICTED: 60S ribosomal protein L7a-like [Cucumis sativus] gi|449506496|ref|XP_004162766.1| PREDICTED: 60S ribosomal protein L7a-like [Cucumis sativus] Length = 257 Score = 68.2 bits (165), Expect(2) = 4e-13 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = +1 Query: 115 IDFIELVVWLPALCRKMEIPYAIVKGKARLGAIVH 219 +D IELVVWLPALCRKMEIPY IVKGKARLGA+VH Sbjct: 152 VDPIELVVWLPALCRKMEIPYCIVKGKARLGAVVH 186 Score = 32.0 bits (71), Expect(2) = 4e-13 Identities = 12/19 (63%), Positives = 18/19 (94%) Frame = +2 Query: 56 THILYQNKAQMVIIAHDVE 112 T+++ QNKAQ+V+IAHDV+ Sbjct: 135 TYLIEQNKAQLVVIAHDVD 153 >emb|CBI15705.3| unnamed protein product [Vitis vinifera] Length = 300 Score = 67.4 bits (163), Expect(2) = 6e-13 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = +1 Query: 115 IDFIELVVWLPALCRKMEIPYAIVKGKARLGAIVH 219 +D IELVVWLPALCRKMEIPY IVKGK+RLGAIVH Sbjct: 195 VDPIELVVWLPALCRKMEIPYCIVKGKSRLGAIVH 229 Score = 32.0 bits (71), Expect(2) = 6e-13 Identities = 12/19 (63%), Positives = 18/19 (94%) Frame = +2 Query: 56 THILYQNKAQMVIIAHDVE 112 T+++ QNKAQ+V+IAHDV+ Sbjct: 178 TYLIEQNKAQLVVIAHDVD 196 >ref|XP_004307051.1| PREDICTED: 60S ribosomal protein L7a-2-like [Fragaria vesca subsp. vesca] Length = 259 Score = 67.4 bits (163), Expect(2) = 6e-13 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = +1 Query: 115 IDFIELVVWLPALCRKMEIPYAIVKGKARLGAIVH 219 +D IELVVWLPALCRKM+IPY IVKGKARLGAIVH Sbjct: 154 VDPIELVVWLPALCRKMQIPYCIVKGKARLGAIVH 188 Score = 32.0 bits (71), Expect(2) = 6e-13 Identities = 12/19 (63%), Positives = 18/19 (94%) Frame = +2 Query: 56 THILYQNKAQMVIIAHDVE 112 T+++ QNKAQ+V+IAHDV+ Sbjct: 137 TYLIEQNKAQLVVIAHDVD 155 >ref|XP_004240870.1| PREDICTED: 60S ribosomal protein L7a-2-like [Solanum lycopersicum] Length = 259 Score = 67.4 bits (163), Expect(2) = 6e-13 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = +1 Query: 115 IDFIELVVWLPALCRKMEIPYAIVKGKARLGAIVH 219 +D IELVVWLPALCRKMEIPY IVKGKARLG+IVH Sbjct: 154 VDPIELVVWLPALCRKMEIPYCIVKGKARLGSIVH 188 Score = 32.0 bits (71), Expect(2) = 6e-13 Identities = 12/19 (63%), Positives = 18/19 (94%) Frame = +2 Query: 56 THILYQNKAQMVIIAHDVE 112 T+++ QNKAQ+V+IAHDV+ Sbjct: 137 TYLIEQNKAQLVVIAHDVD 155 >gb|ABB87129.1| 60S ribosomal protein L7A-like [Solanum tuberosum] Length = 259 Score = 67.4 bits (163), Expect(2) = 6e-13 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = +1 Query: 115 IDFIELVVWLPALCRKMEIPYAIVKGKARLGAIVH 219 +D IELVVWLPALCRKMEIPY IVKGKARLG+IVH Sbjct: 154 VDPIELVVWLPALCRKMEIPYCIVKGKARLGSIVH 188 Score = 32.0 bits (71), Expect(2) = 6e-13 Identities = 12/19 (63%), Positives = 18/19 (94%) Frame = +2 Query: 56 THILYQNKAQMVIIAHDVE 112 T+++ QNKAQ+V+IAHDV+ Sbjct: 137 TYLIEQNKAQLVVIAHDVD 155 >gb|AFK39670.1| unknown [Lotus japonicus] Length = 259 Score = 67.4 bits (163), Expect(2) = 6e-13 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = +1 Query: 115 IDFIELVVWLPALCRKMEIPYAIVKGKARLGAIVH 219 +D IELVVWLPALCRKMEIPY IVKGKARLG+IVH Sbjct: 154 VDPIELVVWLPALCRKMEIPYCIVKGKARLGSIVH 188 Score = 32.0 bits (71), Expect(2) = 6e-13 Identities = 12/19 (63%), Positives = 18/19 (94%) Frame = +2 Query: 56 THILYQNKAQMVIIAHDVE 112 T+++ QNKAQ+V+IAHDV+ Sbjct: 137 TYLIEQNKAQLVVIAHDVD 155 >ref|XP_006356534.1| PREDICTED: 60S ribosomal protein L7a-2-like [Solanum tuberosum] Length = 258 Score = 67.4 bits (163), Expect(2) = 6e-13 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = +1 Query: 115 IDFIELVVWLPALCRKMEIPYAIVKGKARLGAIVH 219 +D IELVVWLPALCRKMEIPY IVKGKARLG+IVH Sbjct: 153 VDPIELVVWLPALCRKMEIPYCIVKGKARLGSIVH 187 Score = 32.0 bits (71), Expect(2) = 6e-13 Identities = 12/19 (63%), Positives = 18/19 (94%) Frame = +2 Query: 56 THILYQNKAQMVIIAHDVE 112 T+++ QNKAQ+V+IAHDV+ Sbjct: 136 TYLIEQNKAQLVVIAHDVD 154 >ref|XP_004241895.1| PREDICTED: 60S ribosomal protein L7a-2-like [Solanum lycopersicum] Length = 258 Score = 67.4 bits (163), Expect(2) = 6e-13 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = +1 Query: 115 IDFIELVVWLPALCRKMEIPYAIVKGKARLGAIVH 219 +D IELVVWLPALCRKMEIPY IVKGKARLG+IVH Sbjct: 153 VDPIELVVWLPALCRKMEIPYCIVKGKARLGSIVH 187 Score = 32.0 bits (71), Expect(2) = 6e-13 Identities = 12/19 (63%), Positives = 18/19 (94%) Frame = +2 Query: 56 THILYQNKAQMVIIAHDVE 112 T+++ QNKAQ+V+IAHDV+ Sbjct: 136 TYLIEQNKAQLVVIAHDVD 154 >ref|XP_004241894.1| PREDICTED: 60S ribosomal protein L7a-2-like [Solanum lycopersicum] Length = 258 Score = 67.4 bits (163), Expect(2) = 6e-13 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = +1 Query: 115 IDFIELVVWLPALCRKMEIPYAIVKGKARLGAIVH 219 +D IELVVWLPALCRKMEIPY IVKGKARLG+IVH Sbjct: 153 VDPIELVVWLPALCRKMEIPYCIVKGKARLGSIVH 187 Score = 32.0 bits (71), Expect(2) = 6e-13 Identities = 12/19 (63%), Positives = 18/19 (94%) Frame = +2 Query: 56 THILYQNKAQMVIIAHDVE 112 T+++ QNKAQ+V+IAHDV+ Sbjct: 136 TYLIEQNKAQLVVIAHDVD 154