BLASTX nr result
ID: Papaver27_contig00008458
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00008458 (509 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACJ65004.1| myo-inositol 1-phosphate synthase type 2 [Brassic... 67 2e-09 ref|XP_007163636.1| hypothetical protein PHAVU_001G251000g [Phas... 66 4e-09 emb|CAH68559.2| myo-inositol 1-phosphate synthase [Phaseolus vul... 66 4e-09 gb|AAK69514.1| 1L-myo-inositol-1-phosphate synthase [Phaseolus v... 66 4e-09 sp|Q9LW96.1|INO1_TOBAC RecName: Full=Inositol-3-phosphate syntha... 65 1e-08 sp|Q9SSV4.1|INO1_NICPA RecName: Full=Inositol-3-phosphate syntha... 65 1e-08 ref|XP_006366522.1| PREDICTED: inositol-3-phosphate synthase [So... 65 1e-08 ref|XP_006366474.1| PREDICTED: inositol-3-phosphate synthase-lik... 65 1e-08 ref|XP_006428149.1| hypothetical protein CICLE_v10025400mg [Citr... 65 1e-08 ref|XP_002307107.2| 1L-myo-inositol 1-phosphate synthase family ... 65 1e-08 ref|XP_006382909.1| hypothetical protein POPTR_0005s08050g [Popu... 65 1e-08 ref|XP_006382908.1| hypothetical protein POPTR_0005s08050g [Popu... 65 1e-08 ref|XP_007048015.1| Myo-inositol-1-phosphate synthase 2 [Theobro... 65 1e-08 ref|XP_007205055.1| hypothetical protein PRUPE_ppa004430mg [Prun... 65 1e-08 ref|XP_004239994.1| PREDICTED: inositol-3-phosphate synthase [So... 65 1e-08 ref|XP_004237418.1| PREDICTED: inositol-3-phosphate synthase [So... 65 1e-08 ref|XP_004143478.1| PREDICTED: inositol-3-phosphate synthase-lik... 65 1e-08 gb|AAK21969.1| myo-inositol 1-phosphate synthase [Avicennia marina] 65 1e-08 sp|Q9FYV1.1|INO1_SESIN RecName: Full=Inositol-3-phosphate syntha... 65 1e-08 sp|P42802.1|INO1_CITPA RecName: Full=Inositol-3-phosphate syntha... 65 1e-08 >gb|ACJ65004.1| myo-inositol 1-phosphate synthase type 2 [Brassica napus] Length = 510 Score = 67.4 bits (163), Expect = 2e-09 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +2 Query: 2 LSTRIQLKSEKEGKFHSFHPVSTILSYLTKAPLV 103 LSTRIQ KSEKEGKFHSFHPV+TILSYLTKAPLV Sbjct: 439 LSTRIQFKSEKEGKFHSFHPVATILSYLTKAPLV 472 >ref|XP_007163636.1| hypothetical protein PHAVU_001G251000g [Phaseolus vulgaris] gi|561037100|gb|ESW35630.1| hypothetical protein PHAVU_001G251000g [Phaseolus vulgaris] Length = 510 Score = 66.2 bits (160), Expect = 4e-09 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = +2 Query: 2 LSTRIQLKSEKEGKFHSFHPVSTILSYLTKAPLV 103 LSTRIQ K+EKEGKFHSFHPV+TILSYLTKAPLV Sbjct: 439 LSTRIQFKAEKEGKFHSFHPVATILSYLTKAPLV 472 >emb|CAH68559.2| myo-inositol 1-phosphate synthase [Phaseolus vulgaris] gi|70720795|emb|CAJ15162.1| myo inositol 1-phosphate synthase [Phaseolus vulgaris] gi|152205693|emb|CAO78895.1| myoinositol 1-phosphate synthase [Phaseolus vulgaris] gi|152205695|emb|CAO78896.1| myoinositol 1-phosphate synthase [Phaseolus vulgaris] Length = 510 Score = 66.2 bits (160), Expect = 4e-09 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = +2 Query: 2 LSTRIQLKSEKEGKFHSFHPVSTILSYLTKAPLV 103 LSTRIQ K+EKEGKFHSFHPV+TILSYLTKAPLV Sbjct: 439 LSTRIQFKAEKEGKFHSFHPVATILSYLTKAPLV 472 >gb|AAK69514.1| 1L-myo-inositol-1-phosphate synthase [Phaseolus vulgaris] Length = 472 Score = 66.2 bits (160), Expect = 4e-09 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = +2 Query: 2 LSTRIQLKSEKEGKFHSFHPVSTILSYLTKAPLV 103 LSTRIQ K+EKEGKFHSFHPV+TILSYLTKAPLV Sbjct: 439 LSTRIQFKAEKEGKFHSFHPVATILSYLTKAPLV 472 >sp|Q9LW96.1|INO1_TOBAC RecName: Full=Inositol-3-phosphate synthase; Short=MIP synthase; AltName: Full=Myo-inositol 1-phosphate synthase; Short=IPS; Short=MI-1-P synthase gi|8096266|dbj|BAA95788.1| myo-inositol 1-phosphate synthase [Nicotiana tabacum] Length = 510 Score = 65.1 bits (157), Expect = 1e-08 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = +2 Query: 2 LSTRIQLKSEKEGKFHSFHPVSTILSYLTKAPLV 103 LSTRIQLK+E EGKFHSFHPV+TILSYLTKAPLV Sbjct: 439 LSTRIQLKAEGEGKFHSFHPVATILSYLTKAPLV 472 >sp|Q9SSV4.1|INO1_NICPA RecName: Full=Inositol-3-phosphate synthase; Short=MIP synthase; AltName: Full=Myo-inositol 1-phosphate synthase; Short=IPS; Short=MI-1-P synthase gi|5834500|dbj|BAA84084.1| myo-inositol-1-phosphate synthase [Nicotiana paniculata] Length = 510 Score = 65.1 bits (157), Expect = 1e-08 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = +2 Query: 2 LSTRIQLKSEKEGKFHSFHPVSTILSYLTKAPLV 103 LSTRIQLK+E EGKFHSFHPV+TILSYLTKAPLV Sbjct: 439 LSTRIQLKAEGEGKFHSFHPVATILSYLTKAPLV 472 >ref|XP_006366522.1| PREDICTED: inositol-3-phosphate synthase [Solanum tuberosum] Length = 510 Score = 65.1 bits (157), Expect = 1e-08 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = +2 Query: 2 LSTRIQLKSEKEGKFHSFHPVSTILSYLTKAPLV 103 LSTRIQLK+E EGKFHSFHPV+TILSYLTKAPLV Sbjct: 439 LSTRIQLKAEGEGKFHSFHPVATILSYLTKAPLV 472 >ref|XP_006366474.1| PREDICTED: inositol-3-phosphate synthase-like [Solanum tuberosum] Length = 510 Score = 65.1 bits (157), Expect = 1e-08 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = +2 Query: 2 LSTRIQLKSEKEGKFHSFHPVSTILSYLTKAPLV 103 LSTRIQLK+E EGKFHSFHPV+TILSYLTKAPLV Sbjct: 439 LSTRIQLKAEGEGKFHSFHPVATILSYLTKAPLV 472 >ref|XP_006428149.1| hypothetical protein CICLE_v10025400mg [Citrus clementina] gi|568819435|ref|XP_006464258.1| PREDICTED: inositol-3-phosphate synthase-like [Citrus sinensis] gi|557530139|gb|ESR41389.1| hypothetical protein CICLE_v10025400mg [Citrus clementina] Length = 510 Score = 65.1 bits (157), Expect = 1e-08 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = +2 Query: 2 LSTRIQLKSEKEGKFHSFHPVSTILSYLTKAPLV 103 LSTRIQLK+E EGKFHSFHPV+TILSYLTKAPLV Sbjct: 439 LSTRIQLKAEGEGKFHSFHPVATILSYLTKAPLV 472 >ref|XP_002307107.2| 1L-myo-inositol 1-phosphate synthase family protein [Populus trichocarpa] gi|550338371|gb|EEE94103.2| 1L-myo-inositol 1-phosphate synthase family protein [Populus trichocarpa] Length = 510 Score = 65.1 bits (157), Expect = 1e-08 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = +2 Query: 2 LSTRIQLKSEKEGKFHSFHPVSTILSYLTKAPLV 103 LSTRIQLK E EGKFHSFHPV+TILSYLTKAPLV Sbjct: 439 LSTRIQLKGEAEGKFHSFHPVATILSYLTKAPLV 472 >ref|XP_006382909.1| hypothetical protein POPTR_0005s08050g [Populus trichocarpa] gi|550338369|gb|ERP60706.1| hypothetical protein POPTR_0005s08050g [Populus trichocarpa] Length = 446 Score = 65.1 bits (157), Expect = 1e-08 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = +2 Query: 2 LSTRIQLKSEKEGKFHSFHPVSTILSYLTKAPLV 103 LSTRIQLK E EGKFHSFHPV+TILSYLTKAPLV Sbjct: 375 LSTRIQLKGEAEGKFHSFHPVATILSYLTKAPLV 408 >ref|XP_006382908.1| hypothetical protein POPTR_0005s08050g [Populus trichocarpa] gi|550338368|gb|ERP60705.1| hypothetical protein POPTR_0005s08050g [Populus trichocarpa] Length = 364 Score = 65.1 bits (157), Expect = 1e-08 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = +2 Query: 2 LSTRIQLKSEKEGKFHSFHPVSTILSYLTKAPLV 103 LSTRIQLK E EGKFHSFHPV+TILSYLTKAPLV Sbjct: 293 LSTRIQLKGEAEGKFHSFHPVATILSYLTKAPLV 326 >ref|XP_007048015.1| Myo-inositol-1-phosphate synthase 2 [Theobroma cacao] gi|508700276|gb|EOX92172.1| Myo-inositol-1-phosphate synthase 2 [Theobroma cacao] Length = 510 Score = 65.1 bits (157), Expect = 1e-08 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = +2 Query: 2 LSTRIQLKSEKEGKFHSFHPVSTILSYLTKAPLV 103 LSTRIQLK+E EGKFHSFHPV+TILSYLTKAPLV Sbjct: 439 LSTRIQLKAEGEGKFHSFHPVATILSYLTKAPLV 472 >ref|XP_007205055.1| hypothetical protein PRUPE_ppa004430mg [Prunus persica] gi|462400697|gb|EMJ06254.1| hypothetical protein PRUPE_ppa004430mg [Prunus persica] Length = 510 Score = 65.1 bits (157), Expect = 1e-08 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = +2 Query: 2 LSTRIQLKSEKEGKFHSFHPVSTILSYLTKAPLV 103 LSTRIQLKSE EGKFHSFHPV+TILSYL+KAPLV Sbjct: 439 LSTRIQLKSEAEGKFHSFHPVATILSYLSKAPLV 472 >ref|XP_004239994.1| PREDICTED: inositol-3-phosphate synthase [Solanum lycopersicum] Length = 510 Score = 65.1 bits (157), Expect = 1e-08 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = +2 Query: 2 LSTRIQLKSEKEGKFHSFHPVSTILSYLTKAPLV 103 LSTRIQLK+E EGKFHSFHPV+TILSYLTKAPLV Sbjct: 439 LSTRIQLKAEGEGKFHSFHPVATILSYLTKAPLV 472 >ref|XP_004237418.1| PREDICTED: inositol-3-phosphate synthase [Solanum lycopersicum] Length = 510 Score = 65.1 bits (157), Expect = 1e-08 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = +2 Query: 2 LSTRIQLKSEKEGKFHSFHPVSTILSYLTKAPLV 103 LSTRIQLK+E EGKFHSFHPV+TILSYLTKAPLV Sbjct: 439 LSTRIQLKAEGEGKFHSFHPVATILSYLTKAPLV 472 >ref|XP_004143478.1| PREDICTED: inositol-3-phosphate synthase-like [Cucumis sativus] gi|449504829|ref|XP_004162306.1| PREDICTED: inositol-3-phosphate synthase-like [Cucumis sativus] Length = 510 Score = 65.1 bits (157), Expect = 1e-08 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = +2 Query: 2 LSTRIQLKSEKEGKFHSFHPVSTILSYLTKAPLV 103 LSTRIQLK+E EGKFHSFHPV+TILSYLTKAPLV Sbjct: 439 LSTRIQLKAEGEGKFHSFHPVATILSYLTKAPLV 472 >gb|AAK21969.1| myo-inositol 1-phosphate synthase [Avicennia marina] Length = 509 Score = 65.1 bits (157), Expect = 1e-08 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = +2 Query: 2 LSTRIQLKSEKEGKFHSFHPVSTILSYLTKAPLV 103 LSTRIQLK+E EGKFHSFHPV+TILSYLTKAPLV Sbjct: 438 LSTRIQLKAEGEGKFHSFHPVATILSYLTKAPLV 471 >sp|Q9FYV1.1|INO1_SESIN RecName: Full=Inositol-3-phosphate synthase; Short=MIP synthase; AltName: Full=Myo-inositol 1-phosphate synthase; Short=IPS; Short=MI-1-P synthase gi|9858816|gb|AAG01148.1| myo-inositol 1-phosphate synthase [Sesamum indicum] Length = 510 Score = 65.1 bits (157), Expect = 1e-08 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = +2 Query: 2 LSTRIQLKSEKEGKFHSFHPVSTILSYLTKAPLV 103 LSTRIQLK+E EGKFHSFHPV+TILSYLTKAPLV Sbjct: 439 LSTRIQLKAEGEGKFHSFHPVATILSYLTKAPLV 472 >sp|P42802.1|INO1_CITPA RecName: Full=Inositol-3-phosphate synthase; Short=MIP synthase; AltName: Full=Myo-inositol 1-phosphate synthase; Short=IPS; Short=MI-1-P synthase gi|602565|emb|CAA83565.1| INO1 [Citrus x paradisi] Length = 507 Score = 65.1 bits (157), Expect = 1e-08 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = +2 Query: 2 LSTRIQLKSEKEGKFHSFHPVSTILSYLTKAPLV 103 LSTRIQLK+E EGKFHSFHPV+TILSYLTKAPLV Sbjct: 436 LSTRIQLKAEGEGKFHSFHPVATILSYLTKAPLV 469