BLASTX nr result
ID: Papaver27_contig00008370
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00008370 (1876 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006403036.1| hypothetical protein EUTSA_v10005737mg [Eutr... 65 1e-07 ref|XP_006355648.1| PREDICTED: clathrin heavy chain 1-like [Sola... 65 1e-07 ref|XP_004239947.1| PREDICTED: clathrin heavy chain 1-like [Sola... 65 1e-07 gb|EPS62652.1| hypothetical protein M569_12138, partial [Genlise... 64 2e-07 gb|EYU26805.1| hypothetical protein MIMGU_mgv1a000127mg [Mimulus... 64 3e-07 ref|XP_006435764.1| hypothetical protein CICLE_v10030488mg [Citr... 64 3e-07 ref|XP_007008929.1| Clathrin, heavy chain isoform 6 [Theobroma c... 63 4e-07 ref|XP_007008928.1| Clathrin, heavy chain isoform 5 [Theobroma c... 63 4e-07 ref|XP_007008927.1| Clathrin, heavy chain isoform 4 [Theobroma c... 63 4e-07 ref|XP_007008926.1| Clathrin, heavy chain isoform 3 [Theobroma c... 63 4e-07 ref|XP_007008925.1| Clathrin, heavy chain isoform 2, partial [Th... 63 4e-07 ref|XP_007008924.1| Clathrin, heavy chain isoform 1 [Theobroma c... 63 4e-07 ref|XP_006407764.1| hypothetical protein EUTSA_v10019886mg [Eutr... 63 5e-07 ref|XP_004307649.1| PREDICTED: clathrin heavy chain 1-like [Frag... 63 5e-07 ref|XP_007218882.1| hypothetical protein PRUPE_ppa000130mg [Prun... 63 5e-07 ref|XP_004138417.1| PREDICTED: clathrin heavy chain 1-like [Cucu... 63 5e-07 ref|XP_002269905.1| PREDICTED: clathrin heavy chain 1 [Vitis vin... 63 5e-07 gb|AHV90401.1| clathrin heavy chain 2 [Lotus japonicus] 62 7e-07 ref|XP_006338824.1| PREDICTED: clathrin heavy chain 1-like [Sola... 62 7e-07 ref|XP_007163558.1| hypothetical protein PHAVU_001G244300g [Phas... 62 7e-07 >ref|XP_006403036.1| hypothetical protein EUTSA_v10005737mg [Eutrema salsugineum] gi|557104135|gb|ESQ44489.1| hypothetical protein EUTSA_v10005737mg [Eutrema salsugineum] Length = 1712 Score = 65.1 bits (157), Expect = 1e-07 Identities = 32/51 (62%), Positives = 36/51 (70%) Frame = -1 Query: 433 HRYGLLYVIRKF*LLFVYGWETTIAVYINRISPDPLFLTIEVMSVRCLYDV 281 H+YGL+YVI K LLFVY ET AVY NRISPDP+FLT E SV Y + Sbjct: 281 HKYGLIYVITKLGLLFVYDLETATAVYRNRISPDPIFLTSEAQSVGGFYAI 331 >ref|XP_006355648.1| PREDICTED: clathrin heavy chain 1-like [Solanum tuberosum] Length = 1707 Score = 64.7 bits (156), Expect = 1e-07 Identities = 32/51 (62%), Positives = 36/51 (70%) Frame = -1 Query: 433 HRYGLLYVIRKF*LLFVYGWETTIAVYINRISPDPLFLTIEVMSVRCLYDV 281 H+YGL+YVI K LLFVY ET AVY NRISPDP+FLT E S+ Y V Sbjct: 281 HKYGLIYVITKLGLLFVYDLETATAVYRNRISPDPIFLTSEASSIGGFYAV 331 >ref|XP_004239947.1| PREDICTED: clathrin heavy chain 1-like [Solanum lycopersicum] Length = 1706 Score = 64.7 bits (156), Expect = 1e-07 Identities = 32/51 (62%), Positives = 36/51 (70%) Frame = -1 Query: 433 HRYGLLYVIRKF*LLFVYGWETTIAVYINRISPDPLFLTIEVMSVRCLYDV 281 H+YGL+YVI K LLFVY ET AVY NRISPDP+FLT E S+ Y V Sbjct: 281 HKYGLIYVITKLGLLFVYDLETATAVYRNRISPDPIFLTSEASSIGGFYAV 331 >gb|EPS62652.1| hypothetical protein M569_12138, partial [Genlisea aurea] Length = 493 Score = 63.9 bits (154), Expect = 2e-07 Identities = 31/45 (68%), Positives = 34/45 (75%) Frame = -1 Query: 433 HRYGLLYVIRKF*LLFVYGWETTIAVYINRISPDPLFLTIEVMSV 299 H+YGL+YVI K LLFVY ET AVY NRISPDP+FLT E SV Sbjct: 298 HKYGLIYVITKLGLLFVYDLETATAVYRNRISPDPIFLTAEASSV 342 >gb|EYU26805.1| hypothetical protein MIMGU_mgv1a000127mg [Mimulus guttatus] Length = 1709 Score = 63.5 bits (153), Expect = 3e-07 Identities = 33/51 (64%), Positives = 35/51 (68%) Frame = -1 Query: 433 HRYGLLYVIRKF*LLFVYGWETTIAVYINRISPDPLFLTIEVMSVRCLYDV 281 H+Y LLYVI K LLFVY ET AVY NRISPDP+FLT E SV Y V Sbjct: 281 HKYSLLYVITKLGLLFVYDLETATAVYRNRISPDPIFLTSEASSVGGFYAV 331 >ref|XP_006435764.1| hypothetical protein CICLE_v10030488mg [Citrus clementina] gi|568865883|ref|XP_006486297.1| PREDICTED: clathrin heavy chain 1-like [Citrus sinensis] gi|557537960|gb|ESR49004.1| hypothetical protein CICLE_v10030488mg [Citrus clementina] Length = 1701 Score = 63.5 bits (153), Expect = 3e-07 Identities = 31/51 (60%), Positives = 36/51 (70%) Frame = -1 Query: 433 HRYGLLYVIRKF*LLFVYGWETTIAVYINRISPDPLFLTIEVMSVRCLYDV 281 H+YGL+YVI K LLFVY ET AVY NRISPDP+FLT E S+ Y + Sbjct: 281 HKYGLIYVITKLGLLFVYDLETAAAVYRNRISPDPIFLTSEASSLGGFYAI 331 >ref|XP_007008929.1| Clathrin, heavy chain isoform 6 [Theobroma cacao] gi|508725842|gb|EOY17739.1| Clathrin, heavy chain isoform 6 [Theobroma cacao] Length = 1207 Score = 63.2 bits (152), Expect = 4e-07 Identities = 31/51 (60%), Positives = 35/51 (68%) Frame = -1 Query: 433 HRYGLLYVIRKF*LLFVYGWETTIAVYINRISPDPLFLTIEVMSVRCLYDV 281 H+Y L+YVI K LLFVY ET AVY NRISPDP+FLT E SV Y + Sbjct: 91 HKYSLIYVITKLGLLFVYDLETATAVYRNRISPDPIFLTSEASSVGGFYSI 141 >ref|XP_007008928.1| Clathrin, heavy chain isoform 5 [Theobroma cacao] gi|508725841|gb|EOY17738.1| Clathrin, heavy chain isoform 5 [Theobroma cacao] Length = 1339 Score = 63.2 bits (152), Expect = 4e-07 Identities = 31/51 (60%), Positives = 35/51 (68%) Frame = -1 Query: 433 HRYGLLYVIRKF*LLFVYGWETTIAVYINRISPDPLFLTIEVMSVRCLYDV 281 H+Y L+YVI K LLFVY ET AVY NRISPDP+FLT E SV Y + Sbjct: 158 HKYSLIYVITKLGLLFVYDLETATAVYRNRISPDPIFLTSEASSVGGFYSI 208 >ref|XP_007008927.1| Clathrin, heavy chain isoform 4 [Theobroma cacao] gi|508725840|gb|EOY17737.1| Clathrin, heavy chain isoform 4 [Theobroma cacao] Length = 1450 Score = 63.2 bits (152), Expect = 4e-07 Identities = 31/51 (60%), Positives = 35/51 (68%) Frame = -1 Query: 433 HRYGLLYVIRKF*LLFVYGWETTIAVYINRISPDPLFLTIEVMSVRCLYDV 281 H+Y L+YVI K LLFVY ET AVY NRISPDP+FLT E SV Y + Sbjct: 281 HKYSLIYVITKLGLLFVYDLETATAVYRNRISPDPIFLTSEASSVGGFYSI 331 >ref|XP_007008926.1| Clathrin, heavy chain isoform 3 [Theobroma cacao] gi|508725839|gb|EOY17736.1| Clathrin, heavy chain isoform 3 [Theobroma cacao] Length = 1532 Score = 63.2 bits (152), Expect = 4e-07 Identities = 31/51 (60%), Positives = 35/51 (68%) Frame = -1 Query: 433 HRYGLLYVIRKF*LLFVYGWETTIAVYINRISPDPLFLTIEVMSVRCLYDV 281 H+Y L+YVI K LLFVY ET AVY NRISPDP+FLT E SV Y + Sbjct: 281 HKYSLIYVITKLGLLFVYDLETATAVYRNRISPDPIFLTSEASSVGGFYSI 331 >ref|XP_007008925.1| Clathrin, heavy chain isoform 2, partial [Theobroma cacao] gi|508725838|gb|EOY17735.1| Clathrin, heavy chain isoform 2, partial [Theobroma cacao] Length = 1667 Score = 63.2 bits (152), Expect = 4e-07 Identities = 31/51 (60%), Positives = 35/51 (68%) Frame = -1 Query: 433 HRYGLLYVIRKF*LLFVYGWETTIAVYINRISPDPLFLTIEVMSVRCLYDV 281 H+Y L+YVI K LLFVY ET AVY NRISPDP+FLT E SV Y + Sbjct: 281 HKYSLIYVITKLGLLFVYDLETATAVYRNRISPDPIFLTSEASSVGGFYSI 331 >ref|XP_007008924.1| Clathrin, heavy chain isoform 1 [Theobroma cacao] gi|508725837|gb|EOY17734.1| Clathrin, heavy chain isoform 1 [Theobroma cacao] Length = 1705 Score = 63.2 bits (152), Expect = 4e-07 Identities = 31/51 (60%), Positives = 35/51 (68%) Frame = -1 Query: 433 HRYGLLYVIRKF*LLFVYGWETTIAVYINRISPDPLFLTIEVMSVRCLYDV 281 H+Y L+YVI K LLFVY ET AVY NRISPDP+FLT E SV Y + Sbjct: 281 HKYSLIYVITKLGLLFVYDLETATAVYRNRISPDPIFLTSEASSVGGFYSI 331 >ref|XP_006407764.1| hypothetical protein EUTSA_v10019886mg [Eutrema salsugineum] gi|557108910|gb|ESQ49217.1| hypothetical protein EUTSA_v10019886mg [Eutrema salsugineum] Length = 1702 Score = 62.8 bits (151), Expect = 5e-07 Identities = 31/51 (60%), Positives = 36/51 (70%) Frame = -1 Query: 433 HRYGLLYVIRKF*LLFVYGWETTIAVYINRISPDPLFLTIEVMSVRCLYDV 281 H++GL+YVI K LLFVY ET AVY NRISPDP+FLT E SV Y + Sbjct: 281 HKFGLIYVITKLGLLFVYDLETASAVYRNRISPDPIFLTSEASSVGGFYAI 331 >ref|XP_004307649.1| PREDICTED: clathrin heavy chain 1-like [Fragaria vesca subsp. vesca] Length = 1708 Score = 62.8 bits (151), Expect = 5e-07 Identities = 32/51 (62%), Positives = 35/51 (68%) Frame = -1 Query: 433 HRYGLLYVIRKF*LLFVYGWETTIAVYINRISPDPLFLTIEVMSVRCLYDV 281 H+Y L+YVI K LLFVY ET AVY NRISPDP+FLT E SV Y V Sbjct: 281 HKYSLIYVITKLGLLFVYDLETASAVYRNRISPDPIFLTTEASSVGGFYAV 331 >ref|XP_007218882.1| hypothetical protein PRUPE_ppa000130mg [Prunus persica] gi|462415344|gb|EMJ20081.1| hypothetical protein PRUPE_ppa000130mg [Prunus persica] Length = 1701 Score = 62.8 bits (151), Expect = 5e-07 Identities = 32/51 (62%), Positives = 35/51 (68%) Frame = -1 Query: 433 HRYGLLYVIRKF*LLFVYGWETTIAVYINRISPDPLFLTIEVMSVRCLYDV 281 H+Y L+YVI K LLFVY ET AVY NRISPDP+FLT E SV Y V Sbjct: 281 HKYSLIYVITKLGLLFVYDLETASAVYRNRISPDPIFLTTEASSVGGFYAV 331 >ref|XP_004138417.1| PREDICTED: clathrin heavy chain 1-like [Cucumis sativus] gi|449499116|ref|XP_004160726.1| PREDICTED: clathrin heavy chain 1-like [Cucumis sativus] Length = 1707 Score = 62.8 bits (151), Expect = 5e-07 Identities = 31/51 (60%), Positives = 35/51 (68%) Frame = -1 Query: 433 HRYGLLYVIRKF*LLFVYGWETTIAVYINRISPDPLFLTIEVMSVRCLYDV 281 H+Y L+YVI K LLFVY ET AVY NRISPDP+FLT E SV Y + Sbjct: 281 HKYSLIYVITKLGLLFVYDLETAAAVYRNRISPDPIFLTAEASSVGGFYAI 331 >ref|XP_002269905.1| PREDICTED: clathrin heavy chain 1 [Vitis vinifera] gi|147866332|emb|CAN79917.1| hypothetical protein VITISV_005429 [Vitis vinifera] gi|297736586|emb|CBI25457.3| unnamed protein product [Vitis vinifera] Length = 1704 Score = 62.8 bits (151), Expect = 5e-07 Identities = 30/51 (58%), Positives = 36/51 (70%) Frame = -1 Query: 433 HRYGLLYVIRKF*LLFVYGWETTIAVYINRISPDPLFLTIEVMSVRCLYDV 281 H+YGL+YVI K LLFVY E+ AVY NRISPDP+FLT E S+ Y + Sbjct: 281 HKYGLIYVITKLGLLFVYDLESASAVYRNRISPDPIFLTAEATSIGGFYAI 331 >gb|AHV90401.1| clathrin heavy chain 2 [Lotus japonicus] Length = 1702 Score = 62.4 bits (150), Expect = 7e-07 Identities = 31/51 (60%), Positives = 35/51 (68%) Frame = -1 Query: 433 HRYGLLYVIRKF*LLFVYGWETTIAVYINRISPDPLFLTIEVMSVRCLYDV 281 H+Y L+YVI K LLFVY ET AVY NRISPDP+FLT E SV Y + Sbjct: 282 HKYNLIYVITKLGLLFVYDLETATAVYRNRISPDPIFLTSEATSVGGFYAI 332 >ref|XP_006338824.1| PREDICTED: clathrin heavy chain 1-like [Solanum tuberosum] Length = 1701 Score = 62.4 bits (150), Expect = 7e-07 Identities = 30/51 (58%), Positives = 35/51 (68%) Frame = -1 Query: 433 HRYGLLYVIRKF*LLFVYGWETTIAVYINRISPDPLFLTIEVMSVRCLYDV 281 H+Y L+YVI K LLFVY ET AVY NRISPDP+FLT E S+ Y + Sbjct: 281 HKYSLIYVITKLGLLFVYDLETATAVYRNRISPDPIFLTAEASSIGGFYAI 331 >ref|XP_007163558.1| hypothetical protein PHAVU_001G244300g [Phaseolus vulgaris] gi|561037022|gb|ESW35552.1| hypothetical protein PHAVU_001G244300g [Phaseolus vulgaris] Length = 1701 Score = 62.4 bits (150), Expect = 7e-07 Identities = 31/51 (60%), Positives = 35/51 (68%) Frame = -1 Query: 433 HRYGLLYVIRKF*LLFVYGWETTIAVYINRISPDPLFLTIEVMSVRCLYDV 281 H+Y L+YVI K LLFVY ET AVY NRISPDP+FLT E SV Y + Sbjct: 281 HKYSLIYVITKLGLLFVYDLETATAVYRNRISPDPIFLTSEATSVGGFYAI 331