BLASTX nr result
ID: Papaver27_contig00007601
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00007601 (432 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007035706.1| TRNA (guanine-N-7) methyltransferase isoform... 92 1e-16 ref|XP_006483612.1| PREDICTED: tRNA (guanine-N(7)-)-methyltransf... 91 1e-16 ref|XP_006450120.1| hypothetical protein CICLE_v10009277mg [Citr... 91 1e-16 ref|XP_004501204.1| PREDICTED: tRNA (guanine-N(7)-)-methyltransf... 90 3e-16 ref|XP_004138787.1| PREDICTED: tRNA (guanine-N(7)-)-methyltransf... 90 3e-16 ref|XP_002529629.1| tRNA (guanine-n(7)-)-methyltransferase, puta... 89 6e-16 ref|XP_003603585.1| tRNA (guanine-N(7)-)-methyltransferase [Medi... 89 6e-16 ref|XP_007223703.1| hypothetical protein PRUPE_ppa010368mg [Prun... 88 1e-15 gb|EXC32779.1| tRNA (guanine-N(7)-)-methyltransferase [Morus not... 88 1e-15 ref|XP_006382189.1| tRNA (guanine-N(7)-)-methyltransferase famil... 87 2e-15 ref|XP_003527817.1| PREDICTED: tRNA (guanine-N(7)-)-methyltransf... 87 3e-15 ref|XP_003523726.1| PREDICTED: tRNA (guanine-N(7)-)-methyltransf... 87 3e-15 gb|ACU17624.1| unknown [Glycine max] 87 3e-15 gb|AFK39576.1| unknown [Lotus japonicus] 86 4e-15 ref|XP_004291295.1| PREDICTED: tRNA (guanine-N(7)-)-methyltransf... 86 5e-15 ref|XP_006365048.1| PREDICTED: tRNA (guanine-N(7)-)-methyltransf... 85 9e-15 ref|XP_006371815.1| tRNA (guanine-N(7)-)-methyltransferase famil... 84 2e-14 gb|EYU19304.1| hypothetical protein MIMGU_mgv1a012341mg [Mimulus... 84 3e-14 ref|XP_004233248.1| PREDICTED: tRNA (guanine-N(7)-)-methyltransf... 82 8e-14 ref|XP_006655952.1| PREDICTED: tRNA (guanine-N(7)-)-methyltransf... 81 1e-13 >ref|XP_007035706.1| TRNA (guanine-N-7) methyltransferase isoform 1 [Theobroma cacao] gi|590661559|ref|XP_007035707.1| TRNA (guanine-N-7) methyltransferase isoform 1 [Theobroma cacao] gi|508714735|gb|EOY06632.1| TRNA (guanine-N-7) methyltransferase isoform 1 [Theobroma cacao] gi|508714736|gb|EOY06633.1| TRNA (guanine-N-7) methyltransferase isoform 1 [Theobroma cacao] Length = 251 Score = 91.7 bits (226), Expect = 1e-16 Identities = 39/53 (73%), Positives = 44/53 (83%) Frame = +3 Query: 270 KGNPKSNNTTGLPRKRFYRARAHSNPLSDSHFPVPTAPSEVDYASHYPHYYPS 428 K NP N +TGLPRKRFYRARAHSNPLSDSHFP+P +PS VDY+ HYP +PS Sbjct: 5 KANPTINKSTGLPRKRFYRARAHSNPLSDSHFPIPLSPSHVDYSLHYPQLFPS 57 >ref|XP_006483612.1| PREDICTED: tRNA (guanine-N(7)-)-methyltransferase-like isoform X1 [Citrus sinensis] gi|568860200|ref|XP_006483613.1| PREDICTED: tRNA (guanine-N(7)-)-methyltransferase-like isoform X2 [Citrus sinensis] gi|568860202|ref|XP_006483614.1| PREDICTED: tRNA (guanine-N(7)-)-methyltransferase-like isoform X3 [Citrus sinensis] Length = 252 Score = 91.3 bits (225), Expect = 1e-16 Identities = 38/50 (76%), Positives = 44/50 (88%) Frame = +3 Query: 276 NPKSNNTTGLPRKRFYRARAHSNPLSDSHFPVPTAPSEVDYASHYPHYYP 425 NP + +TGLPRKRFYRARAHSNPLSDSHFPVP +PS VDY+ HYPH++P Sbjct: 7 NPTISKSTGLPRKRFYRARAHSNPLSDSHFPVPISPSHVDYSLHYPHFFP 56 >ref|XP_006450120.1| hypothetical protein CICLE_v10009277mg [Citrus clementina] gi|567916230|ref|XP_006450121.1| hypothetical protein CICLE_v10009277mg [Citrus clementina] gi|567916232|ref|XP_006450122.1| hypothetical protein CICLE_v10009277mg [Citrus clementina] gi|557553346|gb|ESR63360.1| hypothetical protein CICLE_v10009277mg [Citrus clementina] gi|557553347|gb|ESR63361.1| hypothetical protein CICLE_v10009277mg [Citrus clementina] gi|557553348|gb|ESR63362.1| hypothetical protein CICLE_v10009277mg [Citrus clementina] Length = 252 Score = 91.3 bits (225), Expect = 1e-16 Identities = 38/50 (76%), Positives = 44/50 (88%) Frame = +3 Query: 276 NPKSNNTTGLPRKRFYRARAHSNPLSDSHFPVPTAPSEVDYASHYPHYYP 425 NP + +TGLPRKRFYRARAHSNPLSDSHFPVP +PS VDY+ HYPH++P Sbjct: 7 NPTISKSTGLPRKRFYRARAHSNPLSDSHFPVPISPSHVDYSLHYPHFFP 56 >ref|XP_004501204.1| PREDICTED: tRNA (guanine-N(7)-)-methyltransferase-like [Cicer arietinum] Length = 255 Score = 90.1 bits (222), Expect = 3e-16 Identities = 38/51 (74%), Positives = 44/51 (86%) Frame = +3 Query: 276 NPKSNNTTGLPRKRFYRARAHSNPLSDSHFPVPTAPSEVDYASHYPHYYPS 428 NP + +TGLPRKRFYRARAHSNPLSDSHFPVP +PS VDY+ HYP ++PS Sbjct: 7 NPTHSKSTGLPRKRFYRARAHSNPLSDSHFPVPISPSHVDYSLHYPQFFPS 57 >ref|XP_004138787.1| PREDICTED: tRNA (guanine-N(7)-)-methyltransferase-like [Cucumis sativus] gi|449499318|ref|XP_004160784.1| PREDICTED: tRNA (guanine-N(7)-)-methyltransferase-like [Cucumis sativus] Length = 252 Score = 90.1 bits (222), Expect = 3e-16 Identities = 38/53 (71%), Positives = 45/53 (84%) Frame = +3 Query: 270 KGNPKSNNTTGLPRKRFYRARAHSNPLSDSHFPVPTAPSEVDYASHYPHYYPS 428 + NP + +TGLPRKRFYRARAHSNPLSDSHFP+P +PSEVDY+ HYP +PS Sbjct: 5 EANPTISKSTGLPRKRFYRARAHSNPLSDSHFPIPISPSEVDYSLHYPQLFPS 57 >ref|XP_002529629.1| tRNA (guanine-n(7)-)-methyltransferase, putative [Ricinus communis] gi|223530914|gb|EEF32774.1| tRNA (guanine-n(7)-)-methyltransferase, putative [Ricinus communis] Length = 252 Score = 89.0 bits (219), Expect = 6e-16 Identities = 38/52 (73%), Positives = 43/52 (82%) Frame = +3 Query: 270 KGNPKSNNTTGLPRKRFYRARAHSNPLSDSHFPVPTAPSEVDYASHYPHYYP 425 K NP N +TGLPRKRFYRARAHSNPLSDSHFPVP +P +VDY+ HYP +P Sbjct: 5 KANPTINKSTGLPRKRFYRARAHSNPLSDSHFPVPFSPCQVDYSLHYPQIFP 56 >ref|XP_003603585.1| tRNA (guanine-N(7)-)-methyltransferase [Medicago truncatula] gi|355492633|gb|AES73836.1| tRNA (guanine-N(7)-)-methyltransferase [Medicago truncatula] gi|388511605|gb|AFK43864.1| unknown [Medicago truncatula] Length = 255 Score = 89.0 bits (219), Expect = 6e-16 Identities = 38/52 (73%), Positives = 44/52 (84%) Frame = +3 Query: 273 GNPKSNNTTGLPRKRFYRARAHSNPLSDSHFPVPTAPSEVDYASHYPHYYPS 428 GN + +TGLPRKRFYRARAHSNPLSDSHFPVP +PS VDY+ HYP ++PS Sbjct: 6 GNSTFSKSTGLPRKRFYRARAHSNPLSDSHFPVPLSPSHVDYSLHYPQFFPS 57 >ref|XP_007223703.1| hypothetical protein PRUPE_ppa010368mg [Prunus persica] gi|462420639|gb|EMJ24902.1| hypothetical protein PRUPE_ppa010368mg [Prunus persica] Length = 252 Score = 88.2 bits (217), Expect = 1e-15 Identities = 37/53 (69%), Positives = 44/53 (83%) Frame = +3 Query: 270 KGNPKSNNTTGLPRKRFYRARAHSNPLSDSHFPVPTAPSEVDYASHYPHYYPS 428 + NP + +TGLPRKRFYRARAHSNPLSDSHFPVP +P VDY+ HYP ++PS Sbjct: 5 EANPTFSKSTGLPRKRFYRARAHSNPLSDSHFPVPISPGHVDYSLHYPQHFPS 57 >gb|EXC32779.1| tRNA (guanine-N(7)-)-methyltransferase [Morus notabilis] Length = 252 Score = 87.8 bits (216), Expect = 1e-15 Identities = 36/53 (67%), Positives = 44/53 (83%) Frame = +3 Query: 270 KGNPKSNNTTGLPRKRFYRARAHSNPLSDSHFPVPTAPSEVDYASHYPHYYPS 428 + NP + +TGLPRKRFYRARAHSNPLSDSHFP+P +P VDY+ HYP ++PS Sbjct: 5 EANPTLSKSTGLPRKRFYRARAHSNPLSDSHFPIPISPHHVDYSLHYPQFFPS 57 >ref|XP_006382189.1| tRNA (guanine-N(7)-)-methyltransferase family protein [Populus trichocarpa] gi|550337344|gb|ERP59986.1| tRNA (guanine-N(7)-)-methyltransferase family protein [Populus trichocarpa] Length = 252 Score = 87.0 bits (214), Expect = 2e-15 Identities = 37/53 (69%), Positives = 44/53 (83%) Frame = +3 Query: 270 KGNPKSNNTTGLPRKRFYRARAHSNPLSDSHFPVPTAPSEVDYASHYPHYYPS 428 + NP + +TGLPRKRFYRARAHSNPLSDSHFPVP +PS VDY+ HYP ++ S Sbjct: 5 EANPTISKSTGLPRKRFYRARAHSNPLSDSHFPVPISPSHVDYSLHYPQFFSS 57 >ref|XP_003527817.1| PREDICTED: tRNA (guanine-N(7)-)-methyltransferase-like isoform X1 [Glycine max] gi|571459461|ref|XP_006581415.1| PREDICTED: tRNA (guanine-N(7)-)-methyltransferase-like isoform X2 [Glycine max] Length = 255 Score = 86.7 bits (213), Expect = 3e-15 Identities = 38/51 (74%), Positives = 42/51 (82%) Frame = +3 Query: 276 NPKSNNTTGLPRKRFYRARAHSNPLSDSHFPVPTAPSEVDYASHYPHYYPS 428 NP + +TGLPRKRFYRARAHSNPLSDSHFPVP +PS VDY+ HYP PS Sbjct: 7 NPTISKSTGLPRKRFYRARAHSNPLSDSHFPVPISPSHVDYSLHYPQLLPS 57 >ref|XP_003523726.1| PREDICTED: tRNA (guanine-N(7)-)-methyltransferase-like [Glycine max] Length = 255 Score = 86.7 bits (213), Expect = 3e-15 Identities = 37/50 (74%), Positives = 42/50 (84%) Frame = +3 Query: 276 NPKSNNTTGLPRKRFYRARAHSNPLSDSHFPVPTAPSEVDYASHYPHYYP 425 NP + +TGLPRKRFYRARAHSNPLSDSHFPVP +PS VDY+ HYP +P Sbjct: 7 NPTISKSTGLPRKRFYRARAHSNPLSDSHFPVPISPSHVDYSLHYPQLFP 56 >gb|ACU17624.1| unknown [Glycine max] Length = 227 Score = 86.7 bits (213), Expect = 3e-15 Identities = 38/51 (74%), Positives = 42/51 (82%) Frame = +3 Query: 276 NPKSNNTTGLPRKRFYRARAHSNPLSDSHFPVPTAPSEVDYASHYPHYYPS 428 NP + +TGLPRKRFYRARAHSNPLSDSHFPVP +PS VDY+ HYP PS Sbjct: 7 NPTISKSTGLPRKRFYRARAHSNPLSDSHFPVPISPSHVDYSLHYPQLLPS 57 >gb|AFK39576.1| unknown [Lotus japonicus] Length = 255 Score = 86.3 bits (212), Expect = 4e-15 Identities = 37/51 (72%), Positives = 42/51 (82%) Frame = +3 Query: 276 NPKSNNTTGLPRKRFYRARAHSNPLSDSHFPVPTAPSEVDYASHYPHYYPS 428 NP + +TGLPRKRFYRARAHSNPLSDSHFPVP +P VDY+ HYP +PS Sbjct: 7 NPTFSESTGLPRKRFYRARAHSNPLSDSHFPVPISPRHVDYSLHYPQLFPS 57 >ref|XP_004291295.1| PREDICTED: tRNA (guanine-N(7)-)-methyltransferase-like [Fragaria vesca subsp. vesca] Length = 252 Score = 85.9 bits (211), Expect = 5e-15 Identities = 37/47 (78%), Positives = 41/47 (87%) Frame = +3 Query: 288 NNTTGLPRKRFYRARAHSNPLSDSHFPVPTAPSEVDYASHYPHYYPS 428 + +TGLPRKRFYRARAHSNPLSDSHFPVP APS VDY+ HYP +PS Sbjct: 11 SKSTGLPRKRFYRARAHSNPLSDSHFPVPVAPSHVDYSLHYPQLFPS 57 >ref|XP_006365048.1| PREDICTED: tRNA (guanine-N(7)-)-methyltransferase-like [Solanum tuberosum] Length = 244 Score = 85.1 bits (209), Expect = 9e-15 Identities = 37/49 (75%), Positives = 40/49 (81%) Frame = +3 Query: 267 MKGNPKSNNTTGLPRKRFYRARAHSNPLSDSHFPVPTAPSEVDYASHYP 413 M NP N TGLPRKRFYRARAHSNPLSDSHFP+P +P EVDY+ HYP Sbjct: 1 MGENPTHNKKTGLPRKRFYRARAHSNPLSDSHFPIPISPDEVDYSLHYP 49 >ref|XP_006371815.1| tRNA (guanine-N(7)-)-methyltransferase family protein [Populus trichocarpa] gi|550317988|gb|ERP49612.1| tRNA (guanine-N(7)-)-methyltransferase family protein [Populus trichocarpa] Length = 252 Score = 84.3 bits (207), Expect = 2e-14 Identities = 35/51 (68%), Positives = 43/51 (84%) Frame = +3 Query: 270 KGNPKSNNTTGLPRKRFYRARAHSNPLSDSHFPVPTAPSEVDYASHYPHYY 422 + NP + +TGLPRKRFYRARAHSNPLSDSHFPVP +PS VD++ HYP ++ Sbjct: 5 EANPTISKSTGLPRKRFYRARAHSNPLSDSHFPVPISPSHVDFSLHYPQFF 55 >gb|EYU19304.1| hypothetical protein MIMGU_mgv1a012341mg [Mimulus guttatus] Length = 253 Score = 83.6 bits (205), Expect = 3e-14 Identities = 38/57 (66%), Positives = 45/57 (78%) Frame = +3 Query: 255 EQERMKGNPKSNNTTGLPRKRFYRARAHSNPLSDSHFPVPTAPSEVDYASHYPHYYP 425 EQE + N + TTGLPRKRFYRARAHSNPLSDSHFPVP +P++ D A HYP ++P Sbjct: 3 EQESI-ANHTHSKTTGLPRKRFYRARAHSNPLSDSHFPVPASPAQFDCALHYPQFFP 58 >ref|XP_004233248.1| PREDICTED: tRNA (guanine-N(7)-)-methyltransferase-like isoform 1 [Solanum lycopersicum] Length = 259 Score = 82.0 bits (201), Expect = 8e-14 Identities = 37/51 (72%), Positives = 40/51 (78%) Frame = +3 Query: 261 ERMKGNPKSNNTTGLPRKRFYRARAHSNPLSDSHFPVPTAPSEVDYASHYP 413 E M N N TGLPRKRFYRARAHSNPLSDSHFP+P +P EVDY+ HYP Sbjct: 14 EIMGENHTHNKKTGLPRKRFYRARAHSNPLSDSHFPIPISPCEVDYSLHYP 64 >ref|XP_006655952.1| PREDICTED: tRNA (guanine-N(7)-)-methyltransferase-like [Oryza brachyantha] Length = 266 Score = 81.3 bits (199), Expect = 1e-13 Identities = 34/43 (79%), Positives = 38/43 (88%) Frame = +3 Query: 303 LPRKRFYRARAHSNPLSDSHFPVPTAPSEVDYASHYPHYYPSE 431 LPRKRFYRARAHSNPLSDSHFPVP +P EVD + HYP Y+PS+ Sbjct: 24 LPRKRFYRARAHSNPLSDSHFPVPISPDEVDLSQHYPRYFPSD 66