BLASTX nr result
ID: Papaver27_contig00006632
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00006632 (471 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007132778.1| hypothetical protein PHAVU_011G124300g [Phas... 54 4e-07 ref|XP_003527419.1| PREDICTED: 26S proteasome non-ATPase regulat... 54 4e-07 gb|EXB86491.1| 26S proteasome non-ATPase regulatory subunit 2 1A... 51 5e-07 ref|XP_003607505.1| 26S proteasome non-ATPase regulatory subunit... 52 6e-07 ref|XP_003607506.1| 26S proteasome non-ATPase regulatory subunit... 52 6e-07 ref|XP_003539943.1| PREDICTED: 26S proteasome non-ATPase regulat... 53 8e-07 ref|XP_002517858.1| 26S proteasome regulatory subunit rpn1, puta... 52 1e-06 ref|XP_006855535.1| hypothetical protein AMTR_s00057p00213330 [A... 51 1e-06 ref|XP_004303093.1| PREDICTED: 26S proteasome non-ATPase regulat... 50 2e-06 ref|XP_004505542.1| PREDICTED: 26S proteasome non-ATPase regulat... 51 2e-06 ref|XP_006470158.1| PREDICTED: 26S proteasome non-ATPase regulat... 50 3e-06 ref|XP_004144521.1| PREDICTED: 26S proteasome non-ATPase regulat... 51 4e-06 ref|XP_007198928.1| hypothetical protein PRUPE_ppa001162mg [Prun... 51 4e-06 gb|ABR18347.1| unknown [Picea sitchensis] 50 4e-06 ref|XP_006446691.1| hypothetical protein CICLE_v10014210mg [Citr... 50 4e-06 ref|XP_007043679.1| 26S proteasome regulatory subunit S2 1A isof... 52 4e-06 ref|XP_006446692.1| hypothetical protein CICLE_v10014210mg [Citr... 50 4e-06 ref|XP_007043680.1| 26S proteasome regulatory subunit S2 1A isof... 52 4e-06 ref|XP_007043682.1| 26S proteasome regulatory subunit S2 1A isof... 52 4e-06 ref|XP_007043683.1| 26S proteasome regulatory subunit S2 1A isof... 52 4e-06 >ref|XP_007132778.1| hypothetical protein PHAVU_011G124300g [Phaseolus vulgaris] gi|561005778|gb|ESW04772.1| hypothetical protein PHAVU_011G124300g [Phaseolus vulgaris] Length = 885 Score = 54.3 bits (129), Expect(2) = 4e-07 Identities = 25/39 (64%), Positives = 32/39 (82%) Frame = -2 Query: 170 IRKEIRTSTSSMSFVAKPLKFLHPHYGTLDTF*QWKIQS 54 +R+EIRTSTSSM+ V KPLKFL PHYGTL T+ + ++S Sbjct: 65 MRQEIRTSTSSMTSVPKPLKFLRPHYGTLKTYYETMVES 103 Score = 25.4 bits (54), Expect(2) = 4e-07 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = -1 Query: 81 YFLTVEDSELKKCLADTLFVL 19 Y+ T+ +S+LKK LAD L VL Sbjct: 96 YYETMVESDLKKYLADILSVL 116 >ref|XP_003527419.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 2 homolog A-like [Glycine max] Length = 885 Score = 54.3 bits (129), Expect(2) = 4e-07 Identities = 25/39 (64%), Positives = 32/39 (82%) Frame = -2 Query: 170 IRKEIRTSTSSMSFVAKPLKFLHPHYGTLDTF*QWKIQS 54 +R+EIRTSTSSM+ V KPLKFL PHYGTL T+ + ++S Sbjct: 65 MRQEIRTSTSSMTSVPKPLKFLRPHYGTLKTYYETMVES 103 Score = 25.4 bits (54), Expect(2) = 4e-07 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = -1 Query: 81 YFLTVEDSELKKCLADTLFVL 19 Y+ T+ +S+LKK LAD L VL Sbjct: 96 YYETMVESDLKKYLADILSVL 116 >gb|EXB86491.1| 26S proteasome non-ATPase regulatory subunit 2 1A [Morus notabilis] Length = 899 Score = 50.8 bits (120), Expect(2) = 5e-07 Identities = 23/32 (71%), Positives = 27/32 (84%) Frame = -2 Query: 170 IRKEIRTSTSSMSFVAKPLKFLHPHYGTLDTF 75 +R+EIRTSTSSM+ V KPLKFL PHYGTL + Sbjct: 72 MRQEIRTSTSSMTSVPKPLKFLRPHYGTLKAY 103 Score = 28.5 bits (62), Expect(2) = 5e-07 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = -1 Query: 81 YFLTVEDSELKKCLADTLFVL 19 Y+ T+ DSELKK LAD L VL Sbjct: 103 YYETMADSELKKYLADILSVL 123 >ref|XP_003607505.1| 26S proteasome non-ATPase regulatory subunit [Medicago truncatula] gi|355508560|gb|AES89702.1| 26S proteasome non-ATPase regulatory subunit [Medicago truncatula] Length = 886 Score = 52.4 bits (124), Expect(2) = 6e-07 Identities = 24/39 (61%), Positives = 31/39 (79%) Frame = -2 Query: 170 IRKEIRTSTSSMSFVAKPLKFLHPHYGTLDTF*QWKIQS 54 +R+EIRTSTSSM+ V KPLKFL PHYGTL + + ++S Sbjct: 66 MRQEIRTSTSSMTSVPKPLKFLRPHYGTLKAYYETMVES 104 Score = 26.6 bits (57), Expect(2) = 6e-07 Identities = 13/21 (61%), Positives = 16/21 (76%) Frame = -1 Query: 81 YFLTVEDSELKKCLADTLFVL 19 Y+ T+ +SELKK LAD L VL Sbjct: 97 YYETMVESELKKYLADILSVL 117 >ref|XP_003607506.1| 26S proteasome non-ATPase regulatory subunit [Medicago truncatula] gi|355508561|gb|AES89703.1| 26S proteasome non-ATPase regulatory subunit [Medicago truncatula] Length = 767 Score = 52.4 bits (124), Expect(2) = 6e-07 Identities = 24/39 (61%), Positives = 31/39 (79%) Frame = -2 Query: 170 IRKEIRTSTSSMSFVAKPLKFLHPHYGTLDTF*QWKIQS 54 +R+EIRTSTSSM+ V KPLKFL PHYGTL + + ++S Sbjct: 66 MRQEIRTSTSSMTSVPKPLKFLRPHYGTLKAYYETMVES 104 Score = 26.6 bits (57), Expect(2) = 6e-07 Identities = 13/21 (61%), Positives = 16/21 (76%) Frame = -1 Query: 81 YFLTVEDSELKKCLADTLFVL 19 Y+ T+ +SELKK LAD L VL Sbjct: 97 YYETMVESELKKYLADILSVL 117 >ref|XP_003539943.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 2 homolog A-like [Glycine max] Length = 885 Score = 52.8 bits (125), Expect(2) = 8e-07 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = -2 Query: 170 IRKEIRTSTSSMSFVAKPLKFLHPHYGTLDTF 75 +R+EIRTSTSSM+ V KPLKFL PHYGTL T+ Sbjct: 65 MRQEIRTSTSSMTSVPKPLKFLRPHYGTLKTY 96 Score = 25.8 bits (55), Expect(2) = 8e-07 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = -1 Query: 81 YFLTVEDSELKKCLADTLFVL 19 Y+ T+ +S+LKK LAD L VL Sbjct: 96 YYETMAESDLKKYLADILSVL 116 >ref|XP_002517858.1| 26S proteasome regulatory subunit rpn1, putative [Ricinus communis] gi|223542840|gb|EEF44376.1| 26S proteasome regulatory subunit rpn1, putative [Ricinus communis] Length = 895 Score = 52.0 bits (123), Expect(2) = 1e-06 Identities = 24/32 (75%), Positives = 27/32 (84%) Frame = -2 Query: 170 IRKEIRTSTSSMSFVAKPLKFLHPHYGTLDTF 75 +R+EIRTSTSSM+ V KPLKFL PHYGTL F Sbjct: 74 MRQEIRTSTSSMTSVPKPLKFLRPHYGTLKAF 105 Score = 26.2 bits (56), Expect(2) = 1e-06 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = -1 Query: 81 YFLTVEDSELKKCLADTLFVL 19 ++ T+ DS+LKK LAD L VL Sbjct: 105 FYETMTDSDLKKLLADILSVL 125 >ref|XP_006855535.1| hypothetical protein AMTR_s00057p00213330 [Amborella trichopoda] gi|548859301|gb|ERN17002.1| hypothetical protein AMTR_s00057p00213330 [Amborella trichopoda] Length = 139 Score = 50.8 bits (120), Expect(2) = 1e-06 Identities = 23/32 (71%), Positives = 27/32 (84%) Frame = -2 Query: 170 IRKEIRTSTSSMSFVAKPLKFLHPHYGTLDTF 75 +R+EIRTSTSSM+ V KPLKFL PHYGTL + Sbjct: 68 MRQEIRTSTSSMTSVPKPLKFLRPHYGTLKAY 99 Score = 27.3 bits (59), Expect(2) = 1e-06 Identities = 13/21 (61%), Positives = 16/21 (76%) Frame = -1 Query: 81 YFLTVEDSELKKCLADTLFVL 19 Y+ T+ DS+LKK LAD L VL Sbjct: 99 YYETMADSDLKKYLADILSVL 119 >ref|XP_004303093.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 2 1A-like [Fragaria vesca subsp. vesca] Length = 892 Score = 49.7 bits (117), Expect(2) = 2e-06 Identities = 22/32 (68%), Positives = 27/32 (84%) Frame = -2 Query: 170 IRKEIRTSTSSMSFVAKPLKFLHPHYGTLDTF 75 +R+EIRTSTSSM+ V KPLK+L PHYGTL + Sbjct: 72 MRQEIRTSTSSMTSVPKPLKYLRPHYGTLKAY 103 Score = 27.3 bits (59), Expect(2) = 2e-06 Identities = 13/21 (61%), Positives = 16/21 (76%) Frame = -1 Query: 81 YFLTVEDSELKKCLADTLFVL 19 Y+ T+ DS+LKK LAD L VL Sbjct: 103 YYETMTDSDLKKYLADILSVL 123 >ref|XP_004505542.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 2 1A-like [Cicer arietinum] Length = 886 Score = 50.8 bits (120), Expect(2) = 2e-06 Identities = 23/32 (71%), Positives = 27/32 (84%) Frame = -2 Query: 170 IRKEIRTSTSSMSFVAKPLKFLHPHYGTLDTF 75 +R+EIRTSTSSM+ V KPLKFL PHYGTL + Sbjct: 66 MRQEIRTSTSSMTSVPKPLKFLRPHYGTLKAY 97 Score = 26.2 bits (56), Expect(2) = 2e-06 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = -1 Query: 81 YFLTVEDSELKKCLADTLFVL 19 Y+ T+ +S+LKK LAD L VL Sbjct: 97 YYETMSESDLKKYLADILSVL 117 >ref|XP_006470158.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 2 homolog A-like [Citrus sinensis] Length = 891 Score = 50.1 bits (118), Expect(2) = 3e-06 Identities = 23/32 (71%), Positives = 26/32 (81%) Frame = -2 Query: 170 IRKEIRTSTSSMSFVAKPLKFLHPHYGTLDTF 75 +R EIRTSTSSM+ V KPLKFL PHYGTL + Sbjct: 70 MRTEIRTSTSSMTSVPKPLKFLRPHYGTLKAY 101 Score = 26.6 bits (57), Expect(2) = 3e-06 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = -1 Query: 81 YFLTVEDSELKKCLADTLFVL 19 Y+ T+ DS+LKK +AD L VL Sbjct: 101 YYETMPDSDLKKYMADILSVL 121 >ref|XP_004144521.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 2 1A-like [Cucumis sativus] gi|449522658|ref|XP_004168343.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 2 1A-like [Cucumis sativus] Length = 896 Score = 50.8 bits (120), Expect(2) = 4e-06 Identities = 23/32 (71%), Positives = 27/32 (84%) Frame = -2 Query: 170 IRKEIRTSTSSMSFVAKPLKFLHPHYGTLDTF 75 +R+EIRTSTSSM+ V KPLKFL PHYGTL + Sbjct: 75 MRQEIRTSTSSMTSVPKPLKFLRPHYGTLKAY 106 Score = 25.4 bits (54), Expect(2) = 4e-06 Identities = 11/21 (52%), Positives = 16/21 (76%) Frame = -1 Query: 81 YFLTVEDSELKKCLADTLFVL 19 Y+ T+ D++LKK +AD L VL Sbjct: 106 YYETMADTDLKKYMADILSVL 126 >ref|XP_007198928.1| hypothetical protein PRUPE_ppa001162mg [Prunus persica] gi|462394223|gb|EMJ00127.1| hypothetical protein PRUPE_ppa001162mg [Prunus persica] Length = 892 Score = 50.8 bits (120), Expect(2) = 4e-06 Identities = 23/32 (71%), Positives = 27/32 (84%) Frame = -2 Query: 170 IRKEIRTSTSSMSFVAKPLKFLHPHYGTLDTF 75 +R+EIRTSTSSM+ V KPLK+L PHYGTL F Sbjct: 71 MRQEIRTSTSSMTSVPKPLKYLRPHYGTLKAF 102 Score = 25.4 bits (54), Expect(2) = 4e-06 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = -1 Query: 81 YFLTVEDSELKKCLADTLFVL 19 ++ T+ DS+LKK LAD L VL Sbjct: 102 FYDTMADSDLKKYLADILSVL 122 >gb|ABR18347.1| unknown [Picea sitchensis] Length = 892 Score = 49.7 bits (117), Expect(2) = 4e-06 Identities = 22/32 (68%), Positives = 27/32 (84%) Frame = -2 Query: 170 IRKEIRTSTSSMSFVAKPLKFLHPHYGTLDTF 75 +R+EIRT+TSSM+ V KPLKFL PHYGTL + Sbjct: 67 MRQEIRTATSSMTSVPKPLKFLRPHYGTLKAY 98 Score = 26.6 bits (57), Expect(2) = 4e-06 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = -1 Query: 81 YFLTVEDSELKKCLADTLFVL 19 Y+ T+EDS++K LAD L VL Sbjct: 98 YYETMEDSDVKNYLADILSVL 118 >ref|XP_006446691.1| hypothetical protein CICLE_v10014210mg [Citrus clementina] gi|557549302|gb|ESR59931.1| hypothetical protein CICLE_v10014210mg [Citrus clementina] Length = 891 Score = 50.4 bits (119), Expect(2) = 4e-06 Identities = 24/39 (61%), Positives = 29/39 (74%) Frame = -2 Query: 170 IRKEIRTSTSSMSFVAKPLKFLHPHYGTLDTF*QWKIQS 54 +R EIRTSTSSM+ V KPLKFL PHYGTL + + + S Sbjct: 70 MRTEIRTSTSSMTSVPKPLKFLRPHYGTLKAYYETMLDS 108 Score = 25.8 bits (55), Expect(2) = 4e-06 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = -1 Query: 81 YFLTVEDSELKKCLADTLFVL 19 Y+ T+ DS+LKK +AD L VL Sbjct: 101 YYETMLDSDLKKYMADILSVL 121 >ref|XP_007043679.1| 26S proteasome regulatory subunit S2 1A isoform 1 [Theobroma cacao] gi|508707614|gb|EOX99510.1| 26S proteasome regulatory subunit S2 1A isoform 1 [Theobroma cacao] Length = 885 Score = 52.0 bits (123), Expect(2) = 4e-06 Identities = 24/32 (75%), Positives = 27/32 (84%) Frame = -2 Query: 170 IRKEIRTSTSSMSFVAKPLKFLHPHYGTLDTF 75 +R+EIRTSTSSM+ V KPLKFL PHYGTL F Sbjct: 64 MRQEIRTSTSSMTSVPKPLKFLRPHYGTLKAF 95 Score = 24.3 bits (51), Expect(2) = 4e-06 Identities = 11/21 (52%), Positives = 16/21 (76%) Frame = -1 Query: 81 YFLTVEDSELKKCLADTLFVL 19 ++ T+ +S+LKK LAD L VL Sbjct: 95 FYETMPESDLKKYLADILSVL 115 >ref|XP_006446692.1| hypothetical protein CICLE_v10014210mg [Citrus clementina] gi|557549303|gb|ESR59932.1| hypothetical protein CICLE_v10014210mg [Citrus clementina] Length = 872 Score = 50.4 bits (119), Expect(2) = 4e-06 Identities = 24/39 (61%), Positives = 29/39 (74%) Frame = -2 Query: 170 IRKEIRTSTSSMSFVAKPLKFLHPHYGTLDTF*QWKIQS 54 +R EIRTSTSSM+ V KPLKFL PHYGTL + + + S Sbjct: 70 MRTEIRTSTSSMTSVPKPLKFLRPHYGTLKAYYETMLDS 108 Score = 25.8 bits (55), Expect(2) = 4e-06 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = -1 Query: 81 YFLTVEDSELKKCLADTLFVL 19 Y+ T+ DS+LKK +AD L VL Sbjct: 101 YYETMLDSDLKKYMADILSVL 121 >ref|XP_007043680.1| 26S proteasome regulatory subunit S2 1A isoform 2 [Theobroma cacao] gi|590691068|ref|XP_007043681.1| 26S proteasome regulatory subunit S2 1A isoform 2 [Theobroma cacao] gi|508707615|gb|EOX99511.1| 26S proteasome regulatory subunit S2 1A isoform 2 [Theobroma cacao] gi|508707616|gb|EOX99512.1| 26S proteasome regulatory subunit S2 1A isoform 2 [Theobroma cacao] Length = 769 Score = 52.0 bits (123), Expect(2) = 4e-06 Identities = 24/32 (75%), Positives = 27/32 (84%) Frame = -2 Query: 170 IRKEIRTSTSSMSFVAKPLKFLHPHYGTLDTF 75 +R+EIRTSTSSM+ V KPLKFL PHYGTL F Sbjct: 64 MRQEIRTSTSSMTSVPKPLKFLRPHYGTLKAF 95 Score = 24.3 bits (51), Expect(2) = 4e-06 Identities = 11/21 (52%), Positives = 16/21 (76%) Frame = -1 Query: 81 YFLTVEDSELKKCLADTLFVL 19 ++ T+ +S+LKK LAD L VL Sbjct: 95 FYETMPESDLKKYLADILSVL 115 >ref|XP_007043682.1| 26S proteasome regulatory subunit S2 1A isoform 5 [Theobroma cacao] gi|508707617|gb|EOX99513.1| 26S proteasome regulatory subunit S2 1A isoform 5 [Theobroma cacao] Length = 744 Score = 52.0 bits (123), Expect(2) = 4e-06 Identities = 24/32 (75%), Positives = 27/32 (84%) Frame = -2 Query: 170 IRKEIRTSTSSMSFVAKPLKFLHPHYGTLDTF 75 +R+EIRTSTSSM+ V KPLKFL PHYGTL F Sbjct: 64 MRQEIRTSTSSMTSVPKPLKFLRPHYGTLKAF 95 Score = 24.3 bits (51), Expect(2) = 4e-06 Identities = 11/21 (52%), Positives = 16/21 (76%) Frame = -1 Query: 81 YFLTVEDSELKKCLADTLFVL 19 ++ T+ +S+LKK LAD L VL Sbjct: 95 FYETMPESDLKKYLADILSVL 115 >ref|XP_007043683.1| 26S proteasome regulatory subunit S2 1A isoform 6 [Theobroma cacao] gi|508707618|gb|EOX99514.1| 26S proteasome regulatory subunit S2 1A isoform 6 [Theobroma cacao] Length = 712 Score = 52.0 bits (123), Expect(2) = 4e-06 Identities = 24/32 (75%), Positives = 27/32 (84%) Frame = -2 Query: 170 IRKEIRTSTSSMSFVAKPLKFLHPHYGTLDTF 75 +R+EIRTSTSSM+ V KPLKFL PHYGTL F Sbjct: 64 MRQEIRTSTSSMTSVPKPLKFLRPHYGTLKAF 95 Score = 24.3 bits (51), Expect(2) = 4e-06 Identities = 11/21 (52%), Positives = 16/21 (76%) Frame = -1 Query: 81 YFLTVEDSELKKCLADTLFVL 19 ++ T+ +S+LKK LAD L VL Sbjct: 95 FYETMPESDLKKYLADILSVL 115