BLASTX nr result
ID: Papaver27_contig00006402
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00006402 (489 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004157245.1| PREDICTED: pre-mRNA-splicing factor SF2-like... 67 3e-09 ref|XP_004135598.1| PREDICTED: pre-mRNA-splicing factor SF2-like... 67 3e-09 ref|XP_007144953.1| hypothetical protein PHAVU_007G197400g [Phas... 65 7e-09 ref|XP_007144952.1| hypothetical protein PHAVU_007G197400g [Phas... 65 7e-09 emb|CBI36847.3| unnamed protein product [Vitis vinifera] 65 7e-09 ref|XP_002265998.1| PREDICTED: pre-mRNA-splicing factor SF2-like... 65 7e-09 emb|CAN81258.1| hypothetical protein VITISV_000965 [Vitis vinifera] 65 7e-09 ref|XP_007031015.1| RNA-binding family protein isoform 4 [Theobr... 65 1e-08 ref|XP_007031014.1| RNA-binding family protein isoform 3 [Theobr... 65 1e-08 ref|XP_007031013.1| RNA-binding family protein isoform 2 [Theobr... 65 1e-08 ref|XP_007031012.1| RNA-binding family protein isoform 1 [Theobr... 65 1e-08 ref|XP_007050916.1| RNA-binding family protein isoform 3 [Theobr... 65 1e-08 ref|XP_007050915.1| RNA-binding family protein isoform 2 [Theobr... 65 1e-08 ref|XP_007050914.1| RNA-binding family protein isoform 1 [Theobr... 65 1e-08 ref|XP_004136028.1| PREDICTED: pre-mRNA-splicing factor SF2-like... 65 1e-08 ref|XP_006658109.1| PREDICTED: pre-mRNA-splicing factor SF2-like... 64 2e-08 ref|XP_006417608.1| hypothetical protein EUTSA_v10008203mg [Eutr... 64 2e-08 ref|XP_006417606.1| hypothetical protein EUTSA_v10008203mg [Eutr... 64 2e-08 ref|XP_006382471.1| hypothetical protein POPTR_0005s02450g [Popu... 64 2e-08 ref|XP_006382470.1| hypothetical protein POPTR_0005s02450g [Popu... 64 2e-08 >ref|XP_004157245.1| PREDICTED: pre-mRNA-splicing factor SF2-like [Cucumis sativus] Length = 322 Score = 67.0 bits (162), Expect = 3e-09 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 1 YDDMKYAIRKLDDSEFRNAFSRAYVRVKEYD 93 YDDMKYAIRKLDDSEFRNAFSRAYVRVKEYD Sbjct: 156 YDDMKYAIRKLDDSEFRNAFSRAYVRVKEYD 186 >ref|XP_004135598.1| PREDICTED: pre-mRNA-splicing factor SF2-like [Cucumis sativus] Length = 315 Score = 67.0 bits (162), Expect = 3e-09 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 1 YDDMKYAIRKLDDSEFRNAFSRAYVRVKEYD 93 YDDMKYAIRKLDDSEFRNAFSRAYVRVKEYD Sbjct: 149 YDDMKYAIRKLDDSEFRNAFSRAYVRVKEYD 179 >ref|XP_007144953.1| hypothetical protein PHAVU_007G197400g [Phaseolus vulgaris] gi|561018143|gb|ESW16947.1| hypothetical protein PHAVU_007G197400g [Phaseolus vulgaris] Length = 277 Score = 65.5 bits (158), Expect = 7e-09 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = +1 Query: 1 YDDMKYAIRKLDDSEFRNAFSRAYVRVKEYD 93 YDDMKYAIRKLDDSEFRNAFSRAY+RV+EYD Sbjct: 158 YDDMKYAIRKLDDSEFRNAFSRAYIRVREYD 188 >ref|XP_007144952.1| hypothetical protein PHAVU_007G197400g [Phaseolus vulgaris] gi|561018142|gb|ESW16946.1| hypothetical protein PHAVU_007G197400g [Phaseolus vulgaris] Length = 268 Score = 65.5 bits (158), Expect = 7e-09 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = +1 Query: 1 YDDMKYAIRKLDDSEFRNAFSRAYVRVKEYD 93 YDDMKYAIRKLDDSEFRNAFSRAY+RV+EYD Sbjct: 158 YDDMKYAIRKLDDSEFRNAFSRAYIRVREYD 188 >emb|CBI36847.3| unnamed protein product [Vitis vinifera] Length = 264 Score = 65.5 bits (158), Expect = 7e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +1 Query: 1 YDDMKYAIRKLDDSEFRNAFSRAYVRVKEYD 93 YDDMK+AIRKLDDSEFRNAFSRAYVRVKEYD Sbjct: 158 YDDMKFAIRKLDDSEFRNAFSRAYVRVKEYD 188 >ref|XP_002265998.1| PREDICTED: pre-mRNA-splicing factor SF2-like isoform 1 [Vitis vinifera] gi|359480272|ref|XP_003632425.1| PREDICTED: pre-mRNA-splicing factor SF2-like isoform 2 [Vitis vinifera] Length = 296 Score = 65.5 bits (158), Expect = 7e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +1 Query: 1 YDDMKYAIRKLDDSEFRNAFSRAYVRVKEYD 93 YDDMK+AIRKLDDSEFRNAFSRAYVRVKEYD Sbjct: 158 YDDMKFAIRKLDDSEFRNAFSRAYVRVKEYD 188 >emb|CAN81258.1| hypothetical protein VITISV_000965 [Vitis vinifera] Length = 720 Score = 65.5 bits (158), Expect = 7e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +1 Query: 1 YDDMKYAIRKLDDSEFRNAFSRAYVRVKEYD 93 YDDMK+AIRKLDDSEFRNAFSRAYVRVKEYD Sbjct: 158 YDDMKFAIRKLDDSEFRNAFSRAYVRVKEYD 188 >ref|XP_007031015.1| RNA-binding family protein isoform 4 [Theobroma cacao] gi|508719620|gb|EOY11517.1| RNA-binding family protein isoform 4 [Theobroma cacao] Length = 303 Score = 65.1 bits (157), Expect = 1e-08 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = +1 Query: 1 YDDMKYAIRKLDDSEFRNAFSRAYVRVKEYD 93 YDDMKYAIRKLDDSEFRNAF RAY+RVKEYD Sbjct: 155 YDDMKYAIRKLDDSEFRNAFGRAYIRVKEYD 185 >ref|XP_007031014.1| RNA-binding family protein isoform 3 [Theobroma cacao] gi|508719619|gb|EOY11516.1| RNA-binding family protein isoform 3 [Theobroma cacao] Length = 271 Score = 65.1 bits (157), Expect = 1e-08 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = +1 Query: 1 YDDMKYAIRKLDDSEFRNAFSRAYVRVKEYD 93 YDDMKYAIRKLDDSEFRNAF RAY+RVKEYD Sbjct: 156 YDDMKYAIRKLDDSEFRNAFGRAYIRVKEYD 186 >ref|XP_007031013.1| RNA-binding family protein isoform 2 [Theobroma cacao] gi|508719618|gb|EOY11515.1| RNA-binding family protein isoform 2 [Theobroma cacao] Length = 270 Score = 65.1 bits (157), Expect = 1e-08 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = +1 Query: 1 YDDMKYAIRKLDDSEFRNAFSRAYVRVKEYD 93 YDDMKYAIRKLDDSEFRNAF RAY+RVKEYD Sbjct: 155 YDDMKYAIRKLDDSEFRNAFGRAYIRVKEYD 185 >ref|XP_007031012.1| RNA-binding family protein isoform 1 [Theobroma cacao] gi|508719617|gb|EOY11514.1| RNA-binding family protein isoform 1 [Theobroma cacao] Length = 314 Score = 65.1 bits (157), Expect = 1e-08 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = +1 Query: 1 YDDMKYAIRKLDDSEFRNAFSRAYVRVKEYD 93 YDDMKYAIRKLDDSEFRNAF RAY+RVKEYD Sbjct: 155 YDDMKYAIRKLDDSEFRNAFGRAYIRVKEYD 185 >ref|XP_007050916.1| RNA-binding family protein isoform 3 [Theobroma cacao] gi|508703177|gb|EOX95073.1| RNA-binding family protein isoform 3 [Theobroma cacao] Length = 268 Score = 64.7 bits (156), Expect = 1e-08 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = +1 Query: 1 YDDMKYAIRKLDDSEFRNAFSRAYVRVKEYD 93 YDDMKYAI+KLDDSEFRNAFSRAYVRV+EYD Sbjct: 156 YDDMKYAIKKLDDSEFRNAFSRAYVRVREYD 186 >ref|XP_007050915.1| RNA-binding family protein isoform 2 [Theobroma cacao] gi|508703176|gb|EOX95072.1| RNA-binding family protein isoform 2 [Theobroma cacao] Length = 309 Score = 64.7 bits (156), Expect = 1e-08 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = +1 Query: 1 YDDMKYAIRKLDDSEFRNAFSRAYVRVKEYD 93 YDDMKYAI+KLDDSEFRNAFSRAYVRV+EYD Sbjct: 156 YDDMKYAIKKLDDSEFRNAFSRAYVRVREYD 186 >ref|XP_007050914.1| RNA-binding family protein isoform 1 [Theobroma cacao] gi|508703175|gb|EOX95071.1| RNA-binding family protein isoform 1 [Theobroma cacao] Length = 353 Score = 64.7 bits (156), Expect = 1e-08 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = +1 Query: 1 YDDMKYAIRKLDDSEFRNAFSRAYVRVKEYD 93 YDDMKYAI+KLDDSEFRNAFSRAYVRV+EYD Sbjct: 156 YDDMKYAIKKLDDSEFRNAFSRAYVRVREYD 186 >ref|XP_004136028.1| PREDICTED: pre-mRNA-splicing factor SF2-like [Cucumis sativus] gi|449498497|ref|XP_004160553.1| PREDICTED: pre-mRNA-splicing factor SF2-like [Cucumis sativus] Length = 309 Score = 64.7 bits (156), Expect = 1e-08 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = +1 Query: 1 YDDMKYAIRKLDDSEFRNAFSRAYVRVKEYD 93 YDDMKYAI+KLDDSEFRNAFSRAYVRV+EYD Sbjct: 158 YDDMKYAIKKLDDSEFRNAFSRAYVRVREYD 188 >ref|XP_006658109.1| PREDICTED: pre-mRNA-splicing factor SF2-like isoform X1 [Oryza brachyantha] Length = 288 Score = 64.3 bits (155), Expect = 2e-08 Identities = 28/31 (90%), Positives = 31/31 (100%) Frame = +1 Query: 1 YDDMKYAIRKLDDSEFRNAFSRAYVRVKEYD 93 YDDMKYAIRKLDDSEF+NAFS+AY+RVKEYD Sbjct: 155 YDDMKYAIRKLDDSEFKNAFSKAYIRVKEYD 185 >ref|XP_006417608.1| hypothetical protein EUTSA_v10008203mg [Eutrema salsugineum] gi|557095379|gb|ESQ35961.1| hypothetical protein EUTSA_v10008203mg [Eutrema salsugineum] Length = 283 Score = 64.3 bits (155), Expect = 2e-08 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = +1 Query: 1 YDDMKYAIRKLDDSEFRNAFSRAYVRVKEYD 93 YDDMKYAIRKLDDSEFRNAFSRAYVRV+EY+ Sbjct: 180 YDDMKYAIRKLDDSEFRNAFSRAYVRVREYE 210 >ref|XP_006417606.1| hypothetical protein EUTSA_v10008203mg [Eutrema salsugineum] gi|557095377|gb|ESQ35959.1| hypothetical protein EUTSA_v10008203mg [Eutrema salsugineum] Length = 324 Score = 64.3 bits (155), Expect = 2e-08 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = +1 Query: 1 YDDMKYAIRKLDDSEFRNAFSRAYVRVKEYD 93 YDDMKYAIRKLDDSEFRNAFSRAYVRV+EY+ Sbjct: 180 YDDMKYAIRKLDDSEFRNAFSRAYVRVREYE 210 >ref|XP_006382471.1| hypothetical protein POPTR_0005s02450g [Populus trichocarpa] gi|550337832|gb|ERP60268.1| hypothetical protein POPTR_0005s02450g [Populus trichocarpa] Length = 283 Score = 64.3 bits (155), Expect = 2e-08 Identities = 28/31 (90%), Positives = 31/31 (100%) Frame = +1 Query: 1 YDDMKYAIRKLDDSEFRNAFSRAYVRVKEYD 93 YDDMKYAI+KLDDSEFRNAFSRAY+RV+EYD Sbjct: 157 YDDMKYAIKKLDDSEFRNAFSRAYIRVREYD 187 >ref|XP_006382470.1| hypothetical protein POPTR_0005s02450g [Populus trichocarpa] gi|550337831|gb|ERP60267.1| hypothetical protein POPTR_0005s02450g [Populus trichocarpa] Length = 264 Score = 64.3 bits (155), Expect = 2e-08 Identities = 28/31 (90%), Positives = 31/31 (100%) Frame = +1 Query: 1 YDDMKYAIRKLDDSEFRNAFSRAYVRVKEYD 93 YDDMKYAI+KLDDSEFRNAFSRAY+RV+EYD Sbjct: 157 YDDMKYAIKKLDDSEFRNAFSRAYIRVREYD 187