BLASTX nr result
ID: Papaver27_contig00004291
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00004291 (447 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002517136.1| Protein FRIGIDA, putative [Ricinus communis]... 56 6e-06 >ref|XP_002517136.1| Protein FRIGIDA, putative [Ricinus communis] gi|223543771|gb|EEF45299.1| Protein FRIGIDA, putative [Ricinus communis] Length = 520 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/45 (60%), Positives = 30/45 (66%), Gaps = 1/45 (2%) Frame = -3 Query: 436 PYGYSPEHSSPVMMTSPFTGPALSYPAYGGYSNG-VPVYQQTYYR 305 PY YSPE + P+ + P G LSYPAYGGY NG P YQQ YYR Sbjct: 478 PYAYSPEAAPPIAGSYP--GAPLSYPAYGGYGNGFAPAYQQAYYR 520