BLASTX nr result
ID: Papaver27_contig00003764
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00003764 (1443 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006383741.1| hypothetical protein POPTR_0005s26070g [Popu... 85 9e-14 ref|XP_002307725.1| Chlorophyll a-b binding protein 2 [Populus t... 85 9e-14 gb|EYU43289.1| hypothetical protein MIMGU_mgv11b019945mg [Mimulu... 84 1e-13 gb|EYU43279.1| hypothetical protein MIMGU_mgv1a011871mg [Mimulus... 84 1e-13 gb|EYU43278.1| hypothetical protein MIMGU_mgv1a011933mg [Mimulus... 84 1e-13 sp|P27490.1|CB28_PEA RecName: Full=Chlorophyll a-b binding prote... 84 1e-13 dbj|BAH70299.1| chlorophyll a/b binding protein [Vicia cinerea] 84 1e-13 gb|ABN49454.2| chloroplast chlorophyll a/b binding protein [Pisu... 84 1e-13 gb|AAW31511.1| light-harvesting chlorophyll-a/b binding protein ... 84 1e-13 ref|XP_002316737.1| Chlorophyll a-b binding protein 2 [Populus t... 84 2e-13 gb|EYU19613.1| hypothetical protein MIMGU_mgv1a011885mg [Mimulus... 83 3e-13 ref|NP_001266111.1| chlorophyll a-b binding protein AB80, chloro... 83 3e-13 sp|P27492.1|CB21_TOBAC RecName: Full=Chlorophyll a-b binding pro... 83 3e-13 dbj|BAA25390.1| light harvesting chlorophyll a/b-binding protein... 83 3e-13 sp|P04781.1|CB23_PETSP RecName: Full=Chlorophyll a-b binding pro... 83 3e-13 sp|P07371.1|CB22_PEA RecName: Full=Chlorophyll a-b binding prote... 83 3e-13 ref|XP_006368025.1| PREDICTED: chlorophyll a-b binding protein 1... 83 3e-13 ref|XP_006365561.1| PREDICTED: chlorophyll a-b binding protein 1... 83 3e-13 ref|XP_006364025.1| PREDICTED: chlorophyll a-b binding protein 5... 83 3e-13 ref|XP_004293580.1| PREDICTED: chlorophyll a-b binding protein 4... 83 3e-13 >ref|XP_006383741.1| hypothetical protein POPTR_0005s26070g [Populus trichocarpa] gi|550339766|gb|ERP61538.1| hypothetical protein POPTR_0005s26070g [Populus trichocarpa] Length = 206 Score = 84.7 bits (208), Expect = 9e-14 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = -1 Query: 1443 FFVQAIVTGKGPLENLADHLSDPVNNNAWSYATNFAPGK 1327 FFVQAIVTGKGPLENLADHLSDPVNNNAW+YATNFAPGK Sbjct: 168 FFVQAIVTGKGPLENLADHLSDPVNNNAWAYATNFAPGK 206 >ref|XP_002307725.1| Chlorophyll a-b binding protein 2 [Populus trichocarpa] gi|118485884|gb|ABK94788.1| unknown [Populus trichocarpa] gi|222857174|gb|EEE94721.1| Chlorophyll a-b binding protein 2 [Populus trichocarpa] Length = 264 Score = 84.7 bits (208), Expect = 9e-14 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = -1 Query: 1443 FFVQAIVTGKGPLENLADHLSDPVNNNAWSYATNFAPGK 1327 FFVQAIVTGKGPLENLADHLSDPVNNNAW+YATNFAPGK Sbjct: 226 FFVQAIVTGKGPLENLADHLSDPVNNNAWAYATNFAPGK 264 >gb|EYU43289.1| hypothetical protein MIMGU_mgv11b019945mg [Mimulus guttatus] Length = 265 Score = 84.3 bits (207), Expect = 1e-13 Identities = 38/39 (97%), Positives = 38/39 (97%) Frame = -1 Query: 1443 FFVQAIVTGKGPLENLADHLSDPVNNNAWSYATNFAPGK 1327 FFVQAIVTGKGPLENLADHLSDPVNNNAWSYATNF PGK Sbjct: 227 FFVQAIVTGKGPLENLADHLSDPVNNNAWSYATNFVPGK 265 >gb|EYU43279.1| hypothetical protein MIMGU_mgv1a011871mg [Mimulus guttatus] Length = 268 Score = 84.3 bits (207), Expect = 1e-13 Identities = 38/39 (97%), Positives = 38/39 (97%) Frame = -1 Query: 1443 FFVQAIVTGKGPLENLADHLSDPVNNNAWSYATNFAPGK 1327 FFVQAIVTGKGPLENLADHLSDPVNNNAWSYATNF PGK Sbjct: 230 FFVQAIVTGKGPLENLADHLSDPVNNNAWSYATNFVPGK 268 >gb|EYU43278.1| hypothetical protein MIMGU_mgv1a011933mg [Mimulus guttatus] Length = 266 Score = 84.3 bits (207), Expect = 1e-13 Identities = 38/39 (97%), Positives = 38/39 (97%) Frame = -1 Query: 1443 FFVQAIVTGKGPLENLADHLSDPVNNNAWSYATNFAPGK 1327 FFVQAIVTGKGPLENLADHLSDPVNNNAWSYATNF PGK Sbjct: 228 FFVQAIVTGKGPLENLADHLSDPVNNNAWSYATNFVPGK 266 >sp|P27490.1|CB28_PEA RecName: Full=Chlorophyll a-b binding protein 8, chloroplastic; AltName: Full=LHCII type I CAB-8; Flags: Precursor gi|20669|emb|CAA39883.1| chlorophyll a/b binding protein [Pisum sativum] Length = 268 Score = 84.3 bits (207), Expect = 1e-13 Identities = 38/39 (97%), Positives = 38/39 (97%) Frame = -1 Query: 1443 FFVQAIVTGKGPLENLADHLSDPVNNNAWSYATNFAPGK 1327 FFVQAIVTGKGPLENLADHLSDPVNNNAWSYATNF PGK Sbjct: 230 FFVQAIVTGKGPLENLADHLSDPVNNNAWSYATNFVPGK 268 >dbj|BAH70299.1| chlorophyll a/b binding protein [Vicia cinerea] Length = 266 Score = 84.3 bits (207), Expect = 1e-13 Identities = 38/39 (97%), Positives = 38/39 (97%) Frame = -1 Query: 1443 FFVQAIVTGKGPLENLADHLSDPVNNNAWSYATNFAPGK 1327 FFVQAIVTGKGPLENLADHLSDPVNNNAWSYATNF PGK Sbjct: 228 FFVQAIVTGKGPLENLADHLSDPVNNNAWSYATNFVPGK 266 >gb|ABN49454.2| chloroplast chlorophyll a/b binding protein [Pisum sativum] Length = 266 Score = 84.3 bits (207), Expect = 1e-13 Identities = 38/39 (97%), Positives = 38/39 (97%) Frame = -1 Query: 1443 FFVQAIVTGKGPLENLADHLSDPVNNNAWSYATNFAPGK 1327 FFVQAIVTGKGPLENLADHLSDPVNNNAWSYATNF PGK Sbjct: 228 FFVQAIVTGKGPLENLADHLSDPVNNNAWSYATNFVPGK 266 >gb|AAW31511.1| light-harvesting chlorophyll-a/b binding protein Lhcb1 [Pisum sativum] Length = 266 Score = 84.3 bits (207), Expect = 1e-13 Identities = 38/39 (97%), Positives = 38/39 (97%) Frame = -1 Query: 1443 FFVQAIVTGKGPLENLADHLSDPVNNNAWSYATNFAPGK 1327 FFVQAIVTGKGPLENLADHLSDPVNNNAWSYATNF PGK Sbjct: 228 FFVQAIVTGKGPLENLADHLSDPVNNNAWSYATNFVPGK 266 >ref|XP_002316737.1| Chlorophyll a-b binding protein 2 [Populus trichocarpa] gi|222859802|gb|EEE97349.1| Chlorophyll a-b binding protein 2 [Populus trichocarpa] Length = 264 Score = 83.6 bits (205), Expect = 2e-13 Identities = 37/39 (94%), Positives = 39/39 (100%) Frame = -1 Query: 1443 FFVQAIVTGKGPLENLADHLSDPVNNNAWSYATNFAPGK 1327 FFVQAIVTGKGPLENLADHL+DPVNNNAW+YATNFAPGK Sbjct: 226 FFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFAPGK 264 >gb|EYU19613.1| hypothetical protein MIMGU_mgv1a011885mg [Mimulus guttatus] Length = 267 Score = 83.2 bits (204), Expect = 3e-13 Identities = 37/39 (94%), Positives = 38/39 (97%) Frame = -1 Query: 1443 FFVQAIVTGKGPLENLADHLSDPVNNNAWSYATNFAPGK 1327 FFVQAIVTGKGPLENLADHL+DPVNNNAWSYATNF PGK Sbjct: 229 FFVQAIVTGKGPLENLADHLADPVNNNAWSYATNFVPGK 267 >ref|NP_001266111.1| chlorophyll a-b binding protein AB80, chloroplastic-like [Cicer arietinum] gi|3928140|emb|CAA10284.1| chlorophyll a/b binding protein [Cicer arietinum] Length = 266 Score = 83.2 bits (204), Expect = 3e-13 Identities = 37/39 (94%), Positives = 38/39 (97%) Frame = -1 Query: 1443 FFVQAIVTGKGPLENLADHLSDPVNNNAWSYATNFAPGK 1327 FFVQAIVTGKGPLENLADHLSDPVNNNAW+YATNF PGK Sbjct: 228 FFVQAIVTGKGPLENLADHLSDPVNNNAWAYATNFVPGK 266 >sp|P27492.1|CB21_TOBAC RecName: Full=Chlorophyll a-b binding protein 16, chloroplastic; AltName: Full=LHCII type I CAB-16; Short=LHCP; Flags: Precursor gi|19819|emb|CAA36955.1| unnamed protein product [Nicotiana tabacum] Length = 266 Score = 83.2 bits (204), Expect = 3e-13 Identities = 37/39 (94%), Positives = 38/39 (97%) Frame = -1 Query: 1443 FFVQAIVTGKGPLENLADHLSDPVNNNAWSYATNFAPGK 1327 FFVQAIVTGKGPLENLADHL+DPVNNNAWSYATNF PGK Sbjct: 228 FFVQAIVTGKGPLENLADHLADPVNNNAWSYATNFVPGK 266 >dbj|BAA25390.1| light harvesting chlorophyll a/b-binding protein [Nicotiana sylvestris] Length = 265 Score = 83.2 bits (204), Expect = 3e-13 Identities = 37/39 (94%), Positives = 38/39 (97%) Frame = -1 Query: 1443 FFVQAIVTGKGPLENLADHLSDPVNNNAWSYATNFAPGK 1327 FFVQAIVTGKGPLENLADHL+DPVNNNAWSYATNF PGK Sbjct: 227 FFVQAIVTGKGPLENLADHLADPVNNNAWSYATNFVPGK 265 >sp|P04781.1|CB23_PETSP RecName: Full=Chlorophyll a-b binding protein 22R, chloroplastic; AltName: Full=LHCII type I CAB-22R; Short=LHCP; Flags: Precursor gi|20479|emb|CAA26213.1| unnamed protein product [Petunia sp.] Length = 267 Score = 83.2 bits (204), Expect = 3e-13 Identities = 37/39 (94%), Positives = 38/39 (97%) Frame = -1 Query: 1443 FFVQAIVTGKGPLENLADHLSDPVNNNAWSYATNFAPGK 1327 FFVQAIVTGKGPLENLADHL+DPVNNNAWSYATNF PGK Sbjct: 229 FFVQAIVTGKGPLENLADHLADPVNNNAWSYATNFVPGK 267 >sp|P07371.1|CB22_PEA RecName: Full=Chlorophyll a-b binding protein AB80, chloroplastic; AltName: Full=LHCII type I CAB-AB80; Short=LHCP; Flags: Precursor gi|169053|gb|AAA63413.1| cab precursor [Pisum sativum] gi|169055|gb|AAA33651.1| polypeptide 15 precursor [Pisum sativum] gi|223990|prf||1006296A protein,chlorophyll a/b binding Length = 269 Score = 83.2 bits (204), Expect = 3e-13 Identities = 37/39 (94%), Positives = 38/39 (97%) Frame = -1 Query: 1443 FFVQAIVTGKGPLENLADHLSDPVNNNAWSYATNFAPGK 1327 FFVQAIVTGKGPLENLADHL+DPVNNNAWSYATNF PGK Sbjct: 231 FFVQAIVTGKGPLENLADHLADPVNNNAWSYATNFVPGK 269 >ref|XP_006368025.1| PREDICTED: chlorophyll a-b binding protein 1B, chloroplastic-like [Solanum tuberosum] Length = 265 Score = 83.2 bits (204), Expect = 3e-13 Identities = 37/39 (94%), Positives = 38/39 (97%) Frame = -1 Query: 1443 FFVQAIVTGKGPLENLADHLSDPVNNNAWSYATNFAPGK 1327 FFVQAIVTGKGPLENLADHL+DPVNNNAWSYATNF PGK Sbjct: 227 FFVQAIVTGKGPLENLADHLADPVNNNAWSYATNFVPGK 265 >ref|XP_006365561.1| PREDICTED: chlorophyll a-b binding protein 1B, chloroplastic-like [Solanum tuberosum] Length = 265 Score = 83.2 bits (204), Expect = 3e-13 Identities = 37/39 (94%), Positives = 38/39 (97%) Frame = -1 Query: 1443 FFVQAIVTGKGPLENLADHLSDPVNNNAWSYATNFAPGK 1327 FFVQAIVTGKGPLENLADHL+DPVNNNAWSYATNF PGK Sbjct: 227 FFVQAIVTGKGPLENLADHLADPVNNNAWSYATNFVPGK 265 >ref|XP_006364025.1| PREDICTED: chlorophyll a-b binding protein 50, chloroplastic-like [Solanum tuberosum] Length = 267 Score = 83.2 bits (204), Expect = 3e-13 Identities = 37/39 (94%), Positives = 38/39 (97%) Frame = -1 Query: 1443 FFVQAIVTGKGPLENLADHLSDPVNNNAWSYATNFAPGK 1327 FFVQAIVTGKGPLENLADHL+DPVNNNAWSYATNF PGK Sbjct: 229 FFVQAIVTGKGPLENLADHLADPVNNNAWSYATNFVPGK 267 >ref|XP_004293580.1| PREDICTED: chlorophyll a-b binding protein 40, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 263 Score = 83.2 bits (204), Expect = 3e-13 Identities = 37/39 (94%), Positives = 38/39 (97%) Frame = -1 Query: 1443 FFVQAIVTGKGPLENLADHLSDPVNNNAWSYATNFAPGK 1327 FFVQAIVTGKGPLENLADHL+DPVNNNAWSYATNF PGK Sbjct: 225 FFVQAIVTGKGPLENLADHLADPVNNNAWSYATNFVPGK 263