BLASTX nr result
ID: Papaver27_contig00003529
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00003529 (1150 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006359064.1| PREDICTED: 60S acidic ribosomal protein P3-l... 59 4e-06 ref|XP_002866199.1| hypothetical protein ARALYDRAFT_918901 [Arab... 58 9e-06 >ref|XP_006359064.1| PREDICTED: 60S acidic ribosomal protein P3-like [Solanum tuberosum] Length = 118 Score = 58.9 bits (141), Expect = 4e-06 Identities = 27/39 (69%), Positives = 32/39 (82%) Frame = -2 Query: 117 ADCAYDLERKLVQEALSRDSSGAVQSNFSLITPTSGVFQ 1 A C YDL+RKLVQ AL+ DSSG VQS+FS +TP+S VFQ Sbjct: 28 ASCTYDLQRKLVQAALASDSSGGVQSSFSFVTPSSAVFQ 66 >ref|XP_002866199.1| hypothetical protein ARALYDRAFT_918901 [Arabidopsis lyrata subsp. lyrata] gi|297312034|gb|EFH42458.1| hypothetical protein ARALYDRAFT_918901 [Arabidopsis lyrata subsp. lyrata] Length = 120 Score = 57.8 bits (138), Expect = 9e-06 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = -2 Query: 117 ADCAYDLERKLVQEALSRDSSGAVQSNFSLITPTSGVFQ 1 A YDL+RKLVQ ALS DSSG VQS+FSL++PTS VFQ Sbjct: 28 ASSTYDLQRKLVQTALSADSSGGVQSSFSLVSPTSAVFQ 66