BLASTX nr result
ID: Papaver27_contig00003452
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00003452 (710 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006603778.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 65 2e-08 ref|XP_003554819.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 65 2e-08 ref|XP_003546644.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 65 2e-08 ref|XP_007014344.1| Peptidyl-prolyl cis-trans isomerase-like 4 i... 64 4e-08 ref|XP_007014343.1| Peptidyl-prolyl cis-trans isomerase-like 4 i... 64 4e-08 ref|XP_007133421.1| hypothetical protein PHAVU_011G177200g [Phas... 64 6e-08 ref|XP_004498356.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 64 6e-08 ref|XP_004498355.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 64 6e-08 ref|XP_003636659.1| Peptidyl-prolyl cis-trans isomerase [Medicag... 64 6e-08 ref|XP_003620455.1| Peptidyl-prolyl cis-trans isomerase-like pro... 64 6e-08 ref|XP_002513391.1| peptidyl-prolyl cis-trans isomerase, putativ... 64 6e-08 ref|XP_002307193.2| hypothetical protein POPTR_0005s10020g [Popu... 63 1e-07 ref|XP_006280499.1| hypothetical protein CARUB_v10026436mg [Caps... 62 1e-07 ref|XP_006346045.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 62 2e-07 ref|XP_006392570.1| hypothetical protein EUTSA_v10011414mg [Eutr... 62 2e-07 ref|XP_006392569.1| hypothetical protein EUTSA_v10011414mg [Eutr... 62 2e-07 ref|XP_004243986.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 62 2e-07 gb|AAG51976.1|AC024260_14 hypothetical protein; 15173-12677 [Ara... 62 2e-07 ref|NP_175776.2| cyclophilin 59 [Arabidopsis thaliana] gi|456808... 62 2e-07 gb|AAL24306.1| Unknown protein [Arabidopsis thaliana] 62 2e-07 >ref|XP_006603778.1| PREDICTED: peptidyl-prolyl cis-trans isomerase-like 4-like isoform X2 [Glycine max] Length = 530 Score = 65.1 bits (157), Expect = 2e-08 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = +3 Query: 255 EKIDDEVRLEDDWVPMDEQLGAAELEEVIRKKEAH 359 +++DDEVRLEDDWVPMDEQL AELEEVIR KEAH Sbjct: 77 DEVDDEVRLEDDWVPMDEQLNPAELEEVIRSKEAH 111 >ref|XP_003554819.1| PREDICTED: peptidyl-prolyl cis-trans isomerase-like 4-like isoform X1 [Glycine max] Length = 640 Score = 65.1 bits (157), Expect = 2e-08 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = +3 Query: 255 EKIDDEVRLEDDWVPMDEQLGAAELEEVIRKKEAH 359 +++DDEVRLEDDWVPMDEQL AELEEVIR KEAH Sbjct: 187 DEVDDEVRLEDDWVPMDEQLNPAELEEVIRSKEAH 221 >ref|XP_003546644.1| PREDICTED: peptidyl-prolyl cis-trans isomerase-like 4-like [Glycine max] Length = 633 Score = 65.1 bits (157), Expect = 2e-08 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = +3 Query: 255 EKIDDEVRLEDDWVPMDEQLGAAELEEVIRKKEAH 359 +++DDEVRLEDDWVPMDEQL AELEEVIR KEAH Sbjct: 187 DEVDDEVRLEDDWVPMDEQLNPAELEEVIRSKEAH 221 >ref|XP_007014344.1| Peptidyl-prolyl cis-trans isomerase-like 4 isoform 2 [Theobroma cacao] gi|508784707|gb|EOY31963.1| Peptidyl-prolyl cis-trans isomerase-like 4 isoform 2 [Theobroma cacao] Length = 642 Score = 64.3 bits (155), Expect = 4e-08 Identities = 27/35 (77%), Positives = 33/35 (94%) Frame = +3 Query: 255 EKIDDEVRLEDDWVPMDEQLGAAELEEVIRKKEAH 359 +++DD+VRLEDDWVPMDEQLG AELEEV+R K+AH Sbjct: 187 DEVDDDVRLEDDWVPMDEQLGTAELEEVLRAKDAH 221 >ref|XP_007014343.1| Peptidyl-prolyl cis-trans isomerase-like 4 isoform 1 [Theobroma cacao] gi|508784706|gb|EOY31962.1| Peptidyl-prolyl cis-trans isomerase-like 4 isoform 1 [Theobroma cacao] Length = 593 Score = 64.3 bits (155), Expect = 4e-08 Identities = 27/35 (77%), Positives = 33/35 (94%) Frame = +3 Query: 255 EKIDDEVRLEDDWVPMDEQLGAAELEEVIRKKEAH 359 +++DD+VRLEDDWVPMDEQLG AELEEV+R K+AH Sbjct: 187 DEVDDDVRLEDDWVPMDEQLGTAELEEVLRAKDAH 221 >ref|XP_007133421.1| hypothetical protein PHAVU_011G177200g [Phaseolus vulgaris] gi|561006421|gb|ESW05415.1| hypothetical protein PHAVU_011G177200g [Phaseolus vulgaris] Length = 326 Score = 63.5 bits (153), Expect = 6e-08 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = +3 Query: 255 EKIDDEVRLEDDWVPMDEQLGAAELEEVIRKKEAH 359 ++++DEVRLEDDWVPMDEQL AELEEVIR KEAH Sbjct: 187 DEVEDEVRLEDDWVPMDEQLNPAELEEVIRSKEAH 221 >ref|XP_004498356.1| PREDICTED: peptidyl-prolyl cis-trans isomerase-like 4-like isoform X2 [Cicer arietinum] Length = 565 Score = 63.5 bits (153), Expect = 6e-08 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = +3 Query: 255 EKIDDEVRLEDDWVPMDEQLGAAELEEVIRKKEAH 359 +++DDEVRLEDDWVPMDEQL ELEEVIR KEAH Sbjct: 132 DEVDDEVRLEDDWVPMDEQLNPGELEEVIRSKEAH 166 >ref|XP_004498355.1| PREDICTED: peptidyl-prolyl cis-trans isomerase-like 4-like isoform X1 [Cicer arietinum] Length = 620 Score = 63.5 bits (153), Expect = 6e-08 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = +3 Query: 255 EKIDDEVRLEDDWVPMDEQLGAAELEEVIRKKEAH 359 +++DDEVRLEDDWVPMDEQL ELEEVIR KEAH Sbjct: 187 DEVDDEVRLEDDWVPMDEQLNPGELEEVIRSKEAH 221 >ref|XP_003636659.1| Peptidyl-prolyl cis-trans isomerase [Medicago truncatula] gi|355502594|gb|AES83797.1| Peptidyl-prolyl cis-trans isomerase [Medicago truncatula] Length = 670 Score = 63.5 bits (153), Expect = 6e-08 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = +3 Query: 255 EKIDDEVRLEDDWVPMDEQLGAAELEEVIRKKEAH 359 +++DDEVRLEDDWVPMDEQL ELEEVIR KEAH Sbjct: 252 DEVDDEVRLEDDWVPMDEQLNPGELEEVIRSKEAH 286 >ref|XP_003620455.1| Peptidyl-prolyl cis-trans isomerase-like protein [Medicago truncatula] gi|355495470|gb|AES76673.1| Peptidyl-prolyl cis-trans isomerase-like protein [Medicago truncatula] Length = 621 Score = 63.5 bits (153), Expect = 6e-08 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = +3 Query: 255 EKIDDEVRLEDDWVPMDEQLGAAELEEVIRKKEAH 359 +++DDEVRLEDDWVPMDEQL ELEEVIR KEAH Sbjct: 204 DEVDDEVRLEDDWVPMDEQLNPGELEEVIRSKEAH 238 >ref|XP_002513391.1| peptidyl-prolyl cis-trans isomerase, putative [Ricinus communis] gi|223547299|gb|EEF48794.1| peptidyl-prolyl cis-trans isomerase, putative [Ricinus communis] Length = 587 Score = 63.5 bits (153), Expect = 6e-08 Identities = 27/35 (77%), Positives = 33/35 (94%) Frame = +3 Query: 255 EKIDDEVRLEDDWVPMDEQLGAAELEEVIRKKEAH 359 ++++DEVRLEDDWVPMDEQLG AELEEV+R K+AH Sbjct: 198 QEVEDEVRLEDDWVPMDEQLGPAELEEVLRAKDAH 232 >ref|XP_002307193.2| hypothetical protein POPTR_0005s10020g [Populus trichocarpa] gi|550338518|gb|EEE94189.2| hypothetical protein POPTR_0005s10020g [Populus trichocarpa] Length = 488 Score = 62.8 bits (151), Expect = 1e-07 Identities = 27/35 (77%), Positives = 32/35 (91%) Frame = +3 Query: 255 EKIDDEVRLEDDWVPMDEQLGAAELEEVIRKKEAH 359 +++D +VRLEDDWVPMDEQLG AELEEV+R KEAH Sbjct: 187 DEVDGDVRLEDDWVPMDEQLGTAELEEVLRAKEAH 221 >ref|XP_006280499.1| hypothetical protein CARUB_v10026436mg [Capsella rubella] gi|482549203|gb|EOA13397.1| hypothetical protein CARUB_v10026436mg [Capsella rubella] Length = 433 Score = 62.4 bits (150), Expect = 1e-07 Identities = 26/35 (74%), Positives = 33/35 (94%) Frame = +3 Query: 255 EKIDDEVRLEDDWVPMDEQLGAAELEEVIRKKEAH 359 E+++D+VRLEDDWVPMDE+LG ELEEV+R+KEAH Sbjct: 187 EEVEDDVRLEDDWVPMDEELGVKELEEVMREKEAH 221 >ref|XP_006346045.1| PREDICTED: peptidyl-prolyl cis-trans isomerase-like 4-like [Solanum tuberosum] Length = 587 Score = 61.6 bits (148), Expect = 2e-07 Identities = 26/35 (74%), Positives = 32/35 (91%) Frame = +3 Query: 255 EKIDDEVRLEDDWVPMDEQLGAAELEEVIRKKEAH 359 ++++D+VRLEDDWVPMDEQLG ELEEV+R KEAH Sbjct: 187 DEVEDDVRLEDDWVPMDEQLGMQELEEVLRAKEAH 221 >ref|XP_006392570.1| hypothetical protein EUTSA_v10011414mg [Eutrema salsugineum] gi|557089148|gb|ESQ29856.1| hypothetical protein EUTSA_v10011414mg [Eutrema salsugineum] Length = 499 Score = 61.6 bits (148), Expect = 2e-07 Identities = 27/35 (77%), Positives = 32/35 (91%) Frame = +3 Query: 255 EKIDDEVRLEDDWVPMDEQLGAAELEEVIRKKEAH 359 E++ D+VRLEDDWVPMDE+LGA ELEEVIR+K AH Sbjct: 187 EEVKDDVRLEDDWVPMDEELGAQELEEVIREKAAH 221 >ref|XP_006392569.1| hypothetical protein EUTSA_v10011414mg [Eutrema salsugineum] gi|557089147|gb|ESQ29855.1| hypothetical protein EUTSA_v10011414mg [Eutrema salsugineum] Length = 497 Score = 61.6 bits (148), Expect = 2e-07 Identities = 27/35 (77%), Positives = 32/35 (91%) Frame = +3 Query: 255 EKIDDEVRLEDDWVPMDEQLGAAELEEVIRKKEAH 359 E++ D+VRLEDDWVPMDE+LGA ELEEVIR+K AH Sbjct: 187 EEVKDDVRLEDDWVPMDEELGAQELEEVIREKAAH 221 >ref|XP_004243986.1| PREDICTED: peptidyl-prolyl cis-trans isomerase-like 4-like [Solanum lycopersicum] Length = 587 Score = 61.6 bits (148), Expect = 2e-07 Identities = 26/35 (74%), Positives = 32/35 (91%) Frame = +3 Query: 255 EKIDDEVRLEDDWVPMDEQLGAAELEEVIRKKEAH 359 ++++D+VRLEDDWVPMDEQLG ELEEV+R KEAH Sbjct: 187 DEVEDDVRLEDDWVPMDEQLGMQELEEVLRAKEAH 221 >gb|AAG51976.1|AC024260_14 hypothetical protein; 15173-12677 [Arabidopsis thaliana] Length = 509 Score = 61.6 bits (148), Expect = 2e-07 Identities = 27/35 (77%), Positives = 32/35 (91%) Frame = +3 Query: 255 EKIDDEVRLEDDWVPMDEQLGAAELEEVIRKKEAH 359 E++ D+VRLEDDWVPMDE+LGA ELEEVIR+K AH Sbjct: 187 EEVKDDVRLEDDWVPMDEELGAQELEEVIREKAAH 221 >ref|NP_175776.2| cyclophilin 59 [Arabidopsis thaliana] gi|45680880|gb|AAS75309.1| multidomain cyclophilin type peptidyl-prolyl cis-trans isomerase [Arabidopsis thaliana] gi|332194868|gb|AEE32989.1| cyclophilin 59 [Arabidopsis thaliana] Length = 506 Score = 61.6 bits (148), Expect = 2e-07 Identities = 27/35 (77%), Positives = 32/35 (91%) Frame = +3 Query: 255 EKIDDEVRLEDDWVPMDEQLGAAELEEVIRKKEAH 359 E++ D+VRLEDDWVPMDE+LGA ELEEVIR+K AH Sbjct: 187 EEVKDDVRLEDDWVPMDEELGAQELEEVIREKAAH 221 >gb|AAL24306.1| Unknown protein [Arabidopsis thaliana] Length = 441 Score = 61.6 bits (148), Expect = 2e-07 Identities = 27/35 (77%), Positives = 32/35 (91%) Frame = +3 Query: 255 EKIDDEVRLEDDWVPMDEQLGAAELEEVIRKKEAH 359 E++ D+VRLEDDWVPMDE+LGA ELEEVIR+K AH Sbjct: 187 EEVKDDVRLEDDWVPMDEELGAQELEEVIREKAAH 221