BLASTX nr result
ID: Papaver27_contig00003240
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00003240 (470 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADN34235.1| hypothetical protein [Cucumis melo subsp. melo] 65 1e-08 >gb|ADN34235.1| hypothetical protein [Cucumis melo subsp. melo] Length = 51 Score = 64.7 bits (156), Expect = 1e-08 Identities = 31/40 (77%), Positives = 35/40 (87%) Frame = +1 Query: 142 MCLTYVVAEVTNFKQADPEFRGHEEICYAEPGGVMDYEED 261 MCLTY+VAEVTN KQA+ + R HEEI Y+EPGGVMDYEED Sbjct: 1 MCLTYIVAEVTNCKQANIDIREHEEI-YSEPGGVMDYEED 39