BLASTX nr result
ID: Papaver27_contig00002955
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00002955 (413 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002320072.1| hypothetical protein POPTR_0014s06790g [Popu... 55 8e-06 >ref|XP_002320072.1| hypothetical protein POPTR_0014s06790g [Populus trichocarpa] gi|222860845|gb|EEE98387.1| hypothetical protein POPTR_0014s06790g [Populus trichocarpa] Length = 509 Score = 55.5 bits (132), Expect = 8e-06 Identities = 23/35 (65%), Positives = 29/35 (82%) Frame = -3 Query: 411 FVFKMKDENKPVNYRTMLNLHIDEGLYLQASHRSS 307 F+FK+ DE KPVNYRTM+NLH+D GL++ A HR S Sbjct: 474 FIFKLADERKPVNYRTMINLHVDGGLHVCALHRDS 508