BLASTX nr result
ID: Papaver27_contig00002911
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00002911 (1093 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006474432.1| PREDICTED: conserved oligomeric Golgi comple... 86 4e-14 ref|XP_007222067.1| hypothetical protein PRUPE_ppa003238mg [Prun... 85 6e-14 ref|XP_002308543.1| conserved oligomeric Golgi complex component... 85 6e-14 gb|EYU20335.1| hypothetical protein MIMGU_mgv11b016288mg [Mimulu... 84 1e-13 ref|XP_002279909.2| PREDICTED: conserved oligomeric Golgi comple... 84 1e-13 gb|EXB57652.1| hypothetical protein L484_002999 [Morus notabilis] 83 2e-13 ref|XP_006453061.1| hypothetical protein CICLE_v10007867mg [Citr... 83 2e-13 ref|XP_007012332.1| Oligomeric Golgi complex component-related /... 82 3e-13 ref|XP_007012331.1| Oligomeric Golgi complex component-related /... 82 3e-13 ref|XP_007012330.1| Oligomeric Golgi complex component-related /... 82 3e-13 ref|XP_002516094.1| Conserved oligomeric Golgi complex component... 82 4e-13 ref|XP_004229655.1| PREDICTED: conserved oligomeric Golgi comple... 81 7e-13 ref|XP_006345415.1| PREDICTED: conserved oligomeric Golgi comple... 81 9e-13 ref|XP_004303495.1| PREDICTED: conserved oligomeric Golgi comple... 81 9e-13 gb|EYU29342.1| hypothetical protein MIMGU_mgv1a003572mg [Mimulus... 80 1e-12 ref|XP_006845200.1| hypothetical protein AMTR_s00005p00248640 [A... 80 2e-12 ref|XP_004509412.1| PREDICTED: conserved oligomeric Golgi comple... 80 2e-12 ref|XP_003629209.1| Conserved oligomeric Golgi complex subunit [... 79 3e-12 ref|XP_006399718.1| hypothetical protein EUTSA_v10013117mg [Eutr... 79 4e-12 ref|XP_007156214.1| hypothetical protein PHAVU_003G267800g [Phas... 78 7e-12 >ref|XP_006474432.1| PREDICTED: conserved oligomeric Golgi complex subunit 8-like [Citrus sinensis] gi|343887270|dbj|BAK61816.1| conserved oligomeric Golgi complex component [Citrus unshiu] Length = 568 Score = 85.5 bits (210), Expect = 4e-14 Identities = 43/59 (72%), Positives = 52/59 (88%) Frame = -1 Query: 178 IKTSTPTPNSFSWISSLLPLASVSQQPYVSELLSFTLERLHKEPELLRVDSERIRRQMQ 2 ++T T + S ++SLLPLAS+SQQPYVSELLSFTL+RLHKEPELLRVD+ERI+RQMQ Sbjct: 1 METETGDDATSSSVASLLPLASLSQQPYVSELLSFTLDRLHKEPELLRVDAERIQRQMQ 59 >ref|XP_007222067.1| hypothetical protein PRUPE_ppa003238mg [Prunus persica] gi|462419003|gb|EMJ23266.1| hypothetical protein PRUPE_ppa003238mg [Prunus persica] Length = 590 Score = 84.7 bits (208), Expect = 6e-14 Identities = 42/48 (87%), Positives = 47/48 (97%) Frame = -1 Query: 145 SWISSLLPLASVSQQPYVSELLSFTLERLHKEPELLRVDSERIRRQMQ 2 S ++SLLPLASVSQQPYVSELLSFTL+RLHKEPELLRVD+ERI+RQMQ Sbjct: 11 SAVASLLPLASVSQQPYVSELLSFTLDRLHKEPELLRVDAERIQRQMQ 58 >ref|XP_002308543.1| conserved oligomeric Golgi complex component-related family protein [Populus trichocarpa] gi|222854519|gb|EEE92066.1| conserved oligomeric Golgi complex component-related family protein [Populus trichocarpa] Length = 575 Score = 84.7 bits (208), Expect = 6e-14 Identities = 42/48 (87%), Positives = 47/48 (97%) Frame = -1 Query: 145 SWISSLLPLASVSQQPYVSELLSFTLERLHKEPELLRVDSERIRRQMQ 2 S ++SLLPLASVSQQPYVSELLSFTL+RLHKEPELLRVD+ERI+RQMQ Sbjct: 12 SAVTSLLPLASVSQQPYVSELLSFTLDRLHKEPELLRVDAERIQRQMQ 59 >gb|EYU20335.1| hypothetical protein MIMGU_mgv11b016288mg [Mimulus guttatus] Length = 171 Score = 84.0 bits (206), Expect = 1e-13 Identities = 40/55 (72%), Positives = 51/55 (92%) Frame = -1 Query: 166 TPTPNSFSWISSLLPLASVSQQPYVSELLSFTLERLHKEPELLRVDSERIRRQMQ 2 T + ++++ +S+LLPLAS +QQPYVSELLSFTL+RLHKEPELL+VD+ERIRRQMQ Sbjct: 7 TASSDAYTEMSNLLPLASAAQQPYVSELLSFTLDRLHKEPELLKVDAERIRRQMQ 61 >ref|XP_002279909.2| PREDICTED: conserved oligomeric Golgi complex subunit 8-like [Vitis vinifera] gi|296081667|emb|CBI20672.3| unnamed protein product [Vitis vinifera] Length = 571 Score = 84.0 bits (206), Expect = 1e-13 Identities = 41/46 (89%), Positives = 46/46 (100%) Frame = -1 Query: 139 ISSLLPLASVSQQPYVSELLSFTLERLHKEPELLRVDSERIRRQMQ 2 +++LLPLASVSQQPYVSELLSFTL+RLHKEPELLRVD+ERIRRQMQ Sbjct: 12 MATLLPLASVSQQPYVSELLSFTLDRLHKEPELLRVDAERIRRQMQ 57 >gb|EXB57652.1| hypothetical protein L484_002999 [Morus notabilis] Length = 570 Score = 83.2 bits (204), Expect = 2e-13 Identities = 41/48 (85%), Positives = 44/48 (91%) Frame = -1 Query: 145 SWISSLLPLASVSQQPYVSELLSFTLERLHKEPELLRVDSERIRRQMQ 2 S + LLPLAS SQQPYVSELLSFTL+RLHKEPELLRVD+ERIRRQMQ Sbjct: 11 STVGGLLPLASASQQPYVSELLSFTLDRLHKEPELLRVDAERIRRQMQ 58 >ref|XP_006453061.1| hypothetical protein CICLE_v10007867mg [Citrus clementina] gi|557556287|gb|ESR66301.1| hypothetical protein CICLE_v10007867mg [Citrus clementina] Length = 568 Score = 83.2 bits (204), Expect = 2e-13 Identities = 40/46 (86%), Positives = 46/46 (100%) Frame = -1 Query: 139 ISSLLPLASVSQQPYVSELLSFTLERLHKEPELLRVDSERIRRQMQ 2 ++SLLPLAS+SQQPYVSELLSFTL+RLHKEPELLRVD+ERI+RQMQ Sbjct: 14 VASLLPLASLSQQPYVSELLSFTLDRLHKEPELLRVDAERIQRQMQ 59 >ref|XP_007012332.1| Oligomeric Golgi complex component-related / COG complex component-related isoform 3, partial [Theobroma cacao] gi|508782695|gb|EOY29951.1| Oligomeric Golgi complex component-related / COG complex component-related isoform 3, partial [Theobroma cacao] Length = 427 Score = 82.4 bits (202), Expect = 3e-13 Identities = 41/48 (85%), Positives = 46/48 (95%) Frame = -1 Query: 145 SWISSLLPLASVSQQPYVSELLSFTLERLHKEPELLRVDSERIRRQMQ 2 S ++ LLPLASVSQQPYVSELLSFTL+RLHKEPELLRVD+ERI+RQMQ Sbjct: 20 SAMAGLLPLASVSQQPYVSELLSFTLDRLHKEPELLRVDAERIQRQMQ 67 >ref|XP_007012331.1| Oligomeric Golgi complex component-related / COG complex component-related isoform 2 [Theobroma cacao] gi|508782694|gb|EOY29950.1| Oligomeric Golgi complex component-related / COG complex component-related isoform 2 [Theobroma cacao] Length = 435 Score = 82.4 bits (202), Expect = 3e-13 Identities = 41/48 (85%), Positives = 46/48 (95%) Frame = -1 Query: 145 SWISSLLPLASVSQQPYVSELLSFTLERLHKEPELLRVDSERIRRQMQ 2 S ++ LLPLASVSQQPYVSELLSFTL+RLHKEPELLRVD+ERI+RQMQ Sbjct: 20 SAMAGLLPLASVSQQPYVSELLSFTLDRLHKEPELLRVDAERIQRQMQ 67 >ref|XP_007012330.1| Oligomeric Golgi complex component-related / COG complex component-related isoform 1 [Theobroma cacao] gi|508782693|gb|EOY29949.1| Oligomeric Golgi complex component-related / COG complex component-related isoform 1 [Theobroma cacao] Length = 583 Score = 82.4 bits (202), Expect = 3e-13 Identities = 41/48 (85%), Positives = 46/48 (95%) Frame = -1 Query: 145 SWISSLLPLASVSQQPYVSELLSFTLERLHKEPELLRVDSERIRRQMQ 2 S ++ LLPLASVSQQPYVSELLSFTL+RLHKEPELLRVD+ERI+RQMQ Sbjct: 20 SAMAGLLPLASVSQQPYVSELLSFTLDRLHKEPELLRVDAERIQRQMQ 67 >ref|XP_002516094.1| Conserved oligomeric Golgi complex component, putative [Ricinus communis] gi|223544580|gb|EEF46096.1| Conserved oligomeric Golgi complex component, putative [Ricinus communis] Length = 574 Score = 82.0 bits (201), Expect = 4e-13 Identities = 40/48 (83%), Positives = 47/48 (97%) Frame = -1 Query: 145 SWISSLLPLASVSQQPYVSELLSFTLERLHKEPELLRVDSERIRRQMQ 2 S +++L+PLASVSQQPYVSELLSFTL+RLHKEPELLRVD+ERI+RQMQ Sbjct: 10 SAMANLIPLASVSQQPYVSELLSFTLDRLHKEPELLRVDAERIQRQMQ 57 >ref|XP_004229655.1| PREDICTED: conserved oligomeric Golgi complex subunit 8-like [Solanum lycopersicum] Length = 576 Score = 81.3 bits (199), Expect = 7e-13 Identities = 38/46 (82%), Positives = 44/46 (95%) Frame = -1 Query: 139 ISSLLPLASVSQQPYVSELLSFTLERLHKEPELLRVDSERIRRQMQ 2 ++ LLPLAS +QQPY+SELLSFTL+RLHKEPELLRVD+ERIRRQMQ Sbjct: 15 VTGLLPLASAAQQPYISELLSFTLDRLHKEPELLRVDAERIRRQMQ 60 >ref|XP_006345415.1| PREDICTED: conserved oligomeric Golgi complex subunit 8-like [Solanum tuberosum] Length = 577 Score = 80.9 bits (198), Expect = 9e-13 Identities = 38/46 (82%), Positives = 43/46 (93%) Frame = -1 Query: 139 ISSLLPLASVSQQPYVSELLSFTLERLHKEPELLRVDSERIRRQMQ 2 ++ LPLAS SQQPY+SELLSFTL+RLHKEPELLRVD+ERIRRQMQ Sbjct: 15 VTGFLPLASASQQPYISELLSFTLDRLHKEPELLRVDAERIRRQMQ 60 >ref|XP_004303495.1| PREDICTED: conserved oligomeric Golgi complex subunit 8-like [Fragaria vesca subsp. vesca] Length = 597 Score = 80.9 bits (198), Expect = 9e-13 Identities = 40/48 (83%), Positives = 46/48 (95%) Frame = -1 Query: 145 SWISSLLPLASVSQQPYVSELLSFTLERLHKEPELLRVDSERIRRQMQ 2 S ++SLLPLAS +QQPYVSELLSFTL+RLHKEPELLRVD+ERI+RQMQ Sbjct: 13 SAVASLLPLASGAQQPYVSELLSFTLDRLHKEPELLRVDAERIQRQMQ 60 >gb|EYU29342.1| hypothetical protein MIMGU_mgv1a003572mg [Mimulus guttatus] Length = 577 Score = 80.5 bits (197), Expect = 1e-12 Identities = 39/44 (88%), Positives = 43/44 (97%) Frame = -1 Query: 133 SLLPLASVSQQPYVSELLSFTLERLHKEPELLRVDSERIRRQMQ 2 +LLPLAS +QQPYVSELLSFTL+RLHKEPELLRVD+ERIRRQMQ Sbjct: 21 NLLPLASAAQQPYVSELLSFTLDRLHKEPELLRVDAERIRRQMQ 64 >ref|XP_006845200.1| hypothetical protein AMTR_s00005p00248640 [Amborella trichopoda] gi|548847713|gb|ERN06875.1| hypothetical protein AMTR_s00005p00248640 [Amborella trichopoda] Length = 581 Score = 80.1 bits (196), Expect = 2e-12 Identities = 39/43 (90%), Positives = 42/43 (97%) Frame = -1 Query: 130 LLPLASVSQQPYVSELLSFTLERLHKEPELLRVDSERIRRQMQ 2 LLPLAS +QQPYVSELLSFTL+RLHKEPELLRVD+ERIRRQMQ Sbjct: 18 LLPLASAAQQPYVSELLSFTLDRLHKEPELLRVDAERIRRQMQ 60 >ref|XP_004509412.1| PREDICTED: conserved oligomeric Golgi complex subunit 8-like [Cicer arietinum] Length = 578 Score = 80.1 bits (196), Expect = 2e-12 Identities = 40/46 (86%), Positives = 43/46 (93%) Frame = -1 Query: 139 ISSLLPLASVSQQPYVSELLSFTLERLHKEPELLRVDSERIRRQMQ 2 +S LPLAS SQQPYVSELLSFTL+RLHKEPELLRVD+ERIRRQMQ Sbjct: 14 VSVSLPLASESQQPYVSELLSFTLDRLHKEPELLRVDAERIRRQMQ 59 >ref|XP_003629209.1| Conserved oligomeric Golgi complex subunit [Medicago truncatula] gi|355523231|gb|AET03685.1| Conserved oligomeric Golgi complex subunit [Medicago truncatula] Length = 599 Score = 79.0 bits (193), Expect = 3e-12 Identities = 39/42 (92%), Positives = 41/42 (97%) Frame = -1 Query: 127 LPLASVSQQPYVSELLSFTLERLHKEPELLRVDSERIRRQMQ 2 LPLAS SQQPYVSELLSFTL+RLHKEPELLRVD+ERIRRQMQ Sbjct: 19 LPLASESQQPYVSELLSFTLDRLHKEPELLRVDAERIRRQMQ 60 >ref|XP_006399718.1| hypothetical protein EUTSA_v10013117mg [Eutrema salsugineum] gi|557100808|gb|ESQ41171.1| hypothetical protein EUTSA_v10013117mg [Eutrema salsugineum] Length = 569 Score = 78.6 bits (192), Expect = 4e-12 Identities = 39/45 (86%), Positives = 43/45 (95%) Frame = -1 Query: 136 SSLLPLASVSQQPYVSELLSFTLERLHKEPELLRVDSERIRRQMQ 2 +SLL LAS SQQPYVSELLSFTL+RLHKEPELLRVD+ERI+RQMQ Sbjct: 15 ASLLSLASASQQPYVSELLSFTLDRLHKEPELLRVDAERIQRQMQ 59 >ref|XP_007156214.1| hypothetical protein PHAVU_003G267800g [Phaseolus vulgaris] gi|561029568|gb|ESW28208.1| hypothetical protein PHAVU_003G267800g [Phaseolus vulgaris] Length = 581 Score = 77.8 bits (190), Expect = 7e-12 Identities = 38/42 (90%), Positives = 41/42 (97%) Frame = -1 Query: 127 LPLASVSQQPYVSELLSFTLERLHKEPELLRVDSERIRRQMQ 2 LPLAS SQQPYVSELLSFTL+RLHKEPELLRVD++RIRRQMQ Sbjct: 14 LPLASESQQPYVSELLSFTLDRLHKEPELLRVDADRIRRQMQ 55