BLASTX nr result
ID: Papaver27_contig00002432
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00002432 (700 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002273203.2| PREDICTED: E3 ubiquitin-protein ligase UPL4-... 47 6e-07 ref|XP_002322854.2| hypothetical protein POPTR_0016s08640g [Popu... 46 3e-06 >ref|XP_002273203.2| PREDICTED: E3 ubiquitin-protein ligase UPL4-like [Vitis vinifera] Length = 1575 Score = 47.0 bits (110), Expect(2) = 6e-07 Identities = 27/56 (48%), Positives = 36/56 (64%) Frame = +2 Query: 212 LSFSKKDLNIHDIQSLDPGLGRVLLEFQALGYRKRILGPISAFCVENRMLEL*MSF 379 L+ ++L+++DIQS DP LGRVLLEFQAL RKR L + C E ++ M F Sbjct: 1316 LAILGQELSVYDIQSFDPELGRVLLEFQALIDRKRYLETV---CGEKSTFDVDMCF 1368 Score = 33.1 bits (74), Expect(2) = 6e-07 Identities = 16/31 (51%), Positives = 22/31 (70%), Gaps = 1/31 (3%) Frame = +3 Query: 129 APSGLFPRPLAATMELSNGVR-SRVVKEACL 218 +PSGLFPRP ++T+ SNG+ S V K+ L Sbjct: 1260 SPSGLFPRPWSSTLSTSNGIEFSDVTKQFVL 1290 >ref|XP_002322854.2| hypothetical protein POPTR_0016s08640g [Populus trichocarpa] gi|550321128|gb|EEF04615.2| hypothetical protein POPTR_0016s08640g [Populus trichocarpa] Length = 1545 Score = 45.8 bits (107), Expect(2) = 3e-06 Identities = 21/34 (61%), Positives = 28/34 (82%) Frame = +2 Query: 224 KKDLNIHDIQSLDPGLGRVLLEFQALGYRKRILG 325 +++LN++DIQS DP LGR LLEFQAL RK+ +G Sbjct: 1282 QQELNLYDIQSFDPELGRTLLEFQALVNRKKNMG 1315 Score = 32.0 bits (71), Expect(2) = 3e-06 Identities = 17/47 (36%), Positives = 29/47 (61%), Gaps = 2/47 (4%) Frame = +3 Query: 75 HLKFLEVINKSGKMQNL-GAPSGLFPRPLAATMELSNGVR-SRVVKE 209 H+ F + N + + +P GLFPRP + T++ S+GV+ S V+K+ Sbjct: 1204 HISFPTIENLQAEYSGIVKSPFGLFPRPWSPTVDASDGVQFSEVIKK 1250