BLASTX nr result
ID: Papaver27_contig00002293
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00002293 (447 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006340342.1| PREDICTED: non-specific lipid-transfer prote... 64 2e-08 ref|XP_004251232.1| PREDICTED: non-specific lipid-transfer prote... 64 2e-08 gb|ACM78615.1| non-specific lipid-transfer protein-like protein ... 61 2e-07 ref|XP_004501987.1| PREDICTED: xylogen-like protein 11-like [Cic... 57 3e-06 ref|XP_002521629.1| lipid binding protein, putative [Ricinus com... 56 5e-06 >ref|XP_006340342.1| PREDICTED: non-specific lipid-transfer protein-like protein At2g13820-like [Solanum tuberosum] Length = 206 Score = 64.3 bits (155), Expect = 2e-08 Identities = 27/38 (71%), Positives = 32/38 (84%) Frame = +3 Query: 3 LCQLLGNSSSLGIQLDVNKSLNLPKVCKVETPPVSLCA 116 LCQLLGN +GIQ+DVNK+L LP +CK+ETPPVS CA Sbjct: 98 LCQLLGNPDKIGIQIDVNKALKLPNICKLETPPVSACA 135 >ref|XP_004251232.1| PREDICTED: non-specific lipid-transfer protein-like protein At2g13820-like [Solanum lycopersicum] Length = 206 Score = 64.3 bits (155), Expect = 2e-08 Identities = 27/38 (71%), Positives = 32/38 (84%) Frame = +3 Query: 3 LCQLLGNSSSLGIQLDVNKSLNLPKVCKVETPPVSLCA 116 LCQLLGN +GIQ+DVNK+L LP +CK+ETPPVS CA Sbjct: 98 LCQLLGNPDKIGIQIDVNKALKLPNICKLETPPVSTCA 135 >gb|ACM78615.1| non-specific lipid-transfer protein-like protein [Tamarix hispida] Length = 196 Score = 60.8 bits (146), Expect = 2e-07 Identities = 23/39 (58%), Positives = 34/39 (87%) Frame = +3 Query: 3 LCQLLGNSSSLGIQLDVNKSLNLPKVCKVETPPVSLCAT 119 LC+LLG SS G+Q+D+N++L LP+ CKV+TPP+S+C+T Sbjct: 92 LCELLGKGSSYGLQIDLNRALKLPETCKVDTPPISMCST 130 >ref|XP_004501987.1| PREDICTED: xylogen-like protein 11-like [Cicer arietinum] Length = 209 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/38 (63%), Positives = 31/38 (81%) Frame = +3 Query: 3 LCQLLGNSSSLGIQLDVNKSLNLPKVCKVETPPVSLCA 116 LCQLLGNS S+GI++D NK+L LP +C V TPPV+ C+ Sbjct: 93 LCQLLGNSDSIGIKIDNNKALKLPSLCGVPTPPVTTCS 130 >ref|XP_002521629.1| lipid binding protein, putative [Ricinus communis] gi|223539141|gb|EEF40736.1| lipid binding protein, putative [Ricinus communis] Length = 211 Score = 56.2 bits (134), Expect = 5e-06 Identities = 25/41 (60%), Positives = 33/41 (80%), Gaps = 3/41 (7%) Frame = +3 Query: 3 LCQLLGNSS---SLGIQLDVNKSLNLPKVCKVETPPVSLCA 116 LCQLLGNS+ S G ++DVN++L LP +C+V TPPVSLC+ Sbjct: 103 LCQLLGNSNLTESYGFKIDVNRALKLPSICRVSTPPVSLCS 143