BLASTX nr result
ID: Papaver27_contig00000411
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00000411 (1908 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006577709.1| PREDICTED: uncharacterized protein LOC102668... 62 1e-06 >ref|XP_006577709.1| PREDICTED: uncharacterized protein LOC102668411 [Glycine max] Length = 286 Score = 61.6 bits (148), Expect = 1e-06 Identities = 46/135 (34%), Positives = 61/135 (45%), Gaps = 6/135 (4%) Frame = -2 Query: 416 KESQLAESHS-PPKNALFLMRCRSDPCKNSSMLSRF-----SDNTTDQNYITNTESSQEI 255 K+S A + S PP+NAL L RCRS P ++SS+ SRF D T+ TE Sbjct: 151 KDSDFASNSSTPPRNALLLTRCRSAPYRSSSLASRFWSSPVKDQETEFPIPNTTEQQHTS 210 Query: 254 EKPTLENQVTDNEEKIESCEXXXXXXXXSTVIKDEVGSTVVVDKEKEGGVPLTLTRCKSE 75 E+P E ++ EKI S + + E V + E P LTRCKSE Sbjct: 211 EEPQTEPELGFLREKIAS------------LTEPEKVEEVETETESASSRPTVLTRCKSE 258 Query: 74 PTITRLMKVDD*IEN 30 P T +D + N Sbjct: 259 PARTGHRLLDPLVNN 273