BLASTX nr result
ID: Papaver27_contig00000001
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00000001 (469 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007222067.1| hypothetical protein PRUPE_ppa003238mg [Prun... 89 8e-16 ref|XP_002279909.2| PREDICTED: conserved oligomeric Golgi comple... 88 1e-15 ref|XP_002308543.1| conserved oligomeric Golgi complex component... 86 5e-15 ref|XP_004229655.1| PREDICTED: conserved oligomeric Golgi comple... 86 7e-15 gb|EYU29342.1| hypothetical protein MIMGU_mgv1a003572mg [Mimulus... 85 9e-15 ref|XP_006845200.1| hypothetical protein AMTR_s00005p00248640 [A... 85 9e-15 ref|XP_004303495.1| PREDICTED: conserved oligomeric Golgi comple... 85 9e-15 gb|EYU20335.1| hypothetical protein MIMGU_mgv11b016288mg [Mimulu... 84 2e-14 ref|XP_002516094.1| Conserved oligomeric Golgi complex component... 84 3e-14 gb|EXB57652.1| hypothetical protein L484_002999 [Morus notabilis] 83 3e-14 ref|XP_006345415.1| PREDICTED: conserved oligomeric Golgi comple... 83 4e-14 ref|XP_006453061.1| hypothetical protein CICLE_v10007867mg [Citr... 82 6e-14 ref|XP_006474432.1| PREDICTED: conserved oligomeric Golgi comple... 82 8e-14 ref|XP_007012332.1| Oligomeric Golgi complex component-related /... 82 1e-13 ref|XP_007012331.1| Oligomeric Golgi complex component-related /... 82 1e-13 ref|XP_007012330.1| Oligomeric Golgi complex component-related /... 82 1e-13 ref|XP_004141327.1| PREDICTED: conserved oligomeric Golgi comple... 81 2e-13 ref|XP_004509412.1| PREDICTED: conserved oligomeric Golgi comple... 80 3e-13 ref|NP_001066940.1| Os12g0538300 [Oryza sativa Japonica Group] g... 80 3e-13 gb|EAY83387.1| hypothetical protein OsI_38603 [Oryza sativa Indi... 80 3e-13 >ref|XP_007222067.1| hypothetical protein PRUPE_ppa003238mg [Prunus persica] gi|462419003|gb|EMJ23266.1| hypothetical protein PRUPE_ppa003238mg [Prunus persica] Length = 590 Score = 88.6 bits (218), Expect = 8e-16 Identities = 46/58 (79%), Positives = 55/58 (94%) Frame = +1 Query: 295 QSMDSSEDSTMVASSLLPLASVAQQPYVSELLSFTLERLHKEPELLRVDSERIRRQMQ 468 +S +++EDS+ VAS LLPLASV+QQPYVSELLSFTL+RLHKEPELLRVD+ERI+RQMQ Sbjct: 2 ESENAAEDSSAVAS-LLPLASVSQQPYVSELLSFTLDRLHKEPELLRVDAERIQRQMQ 58 >ref|XP_002279909.2| PREDICTED: conserved oligomeric Golgi complex subunit 8-like [Vitis vinifera] gi|296081667|emb|CBI20672.3| unnamed protein product [Vitis vinifera] Length = 571 Score = 87.8 bits (216), Expect = 1e-15 Identities = 45/55 (81%), Positives = 53/55 (96%) Frame = +1 Query: 304 DSSEDSTMVASSLLPLASVAQQPYVSELLSFTLERLHKEPELLRVDSERIRRQMQ 468 D++EDS+ +A+ LLPLASV+QQPYVSELLSFTL+RLHKEPELLRVD+ERIRRQMQ Sbjct: 4 DAAEDSSPMAT-LLPLASVSQQPYVSELLSFTLDRLHKEPELLRVDAERIRRQMQ 57 >ref|XP_002308543.1| conserved oligomeric Golgi complex component-related family protein [Populus trichocarpa] gi|222854519|gb|EEE92066.1| conserved oligomeric Golgi complex component-related family protein [Populus trichocarpa] Length = 575 Score = 85.9 bits (211), Expect = 5e-15 Identities = 41/55 (74%), Positives = 50/55 (90%) Frame = +1 Query: 304 DSSEDSTMVASSLLPLASVAQQPYVSELLSFTLERLHKEPELLRVDSERIRRQMQ 468 ++ +D + +SLLPLASV+QQPYVSELLSFTL+RLHKEPELLRVD+ERI+RQMQ Sbjct: 5 ENGQDMSSAVTSLLPLASVSQQPYVSELLSFTLDRLHKEPELLRVDAERIQRQMQ 59 >ref|XP_004229655.1| PREDICTED: conserved oligomeric Golgi complex subunit 8-like [Solanum lycopersicum] Length = 576 Score = 85.5 bits (210), Expect = 7e-15 Identities = 44/59 (74%), Positives = 49/59 (83%), Gaps = 2/59 (3%) Frame = +1 Query: 298 SMDSSE--DSTMVASSLLPLASVAQQPYVSELLSFTLERLHKEPELLRVDSERIRRQMQ 468 SMDS + D + LLPLAS AQQPY+SELLSFTL+RLHKEPELLRVD+ERIRRQMQ Sbjct: 2 SMDSEDPMDEASPVTGLLPLASAAQQPYISELLSFTLDRLHKEPELLRVDAERIRRQMQ 60 >gb|EYU29342.1| hypothetical protein MIMGU_mgv1a003572mg [Mimulus guttatus] Length = 577 Score = 85.1 bits (209), Expect = 9e-15 Identities = 42/54 (77%), Positives = 48/54 (88%) Frame = +1 Query: 307 SSEDSTMVASSLLPLASVAQQPYVSELLSFTLERLHKEPELLRVDSERIRRQMQ 468 +++D T +LLPLAS AQQPYVSELLSFTL+RLHKEPELLRVD+ERIRRQMQ Sbjct: 11 ANDDYTTAMLNLLPLASAAQQPYVSELLSFTLDRLHKEPELLRVDAERIRRQMQ 64 >ref|XP_006845200.1| hypothetical protein AMTR_s00005p00248640 [Amborella trichopoda] gi|548847713|gb|ERN06875.1| hypothetical protein AMTR_s00005p00248640 [Amborella trichopoda] Length = 581 Score = 85.1 bits (209), Expect = 9e-15 Identities = 45/55 (81%), Positives = 49/55 (89%) Frame = +1 Query: 304 DSSEDSTMVASSLLPLASVAQQPYVSELLSFTLERLHKEPELLRVDSERIRRQMQ 468 + SE +TM A LLPLAS AQQPYVSELLSFTL+RLHKEPELLRVD+ERIRRQMQ Sbjct: 7 NDSETATM-ALGLLPLASAAQQPYVSELLSFTLDRLHKEPELLRVDAERIRRQMQ 60 >ref|XP_004303495.1| PREDICTED: conserved oligomeric Golgi complex subunit 8-like [Fragaria vesca subsp. vesca] Length = 597 Score = 85.1 bits (209), Expect = 9e-15 Identities = 45/54 (83%), Positives = 51/54 (94%) Frame = +1 Query: 307 SSEDSTMVASSLLPLASVAQQPYVSELLSFTLERLHKEPELLRVDSERIRRQMQ 468 ++EDS+ VAS LLPLAS AQQPYVSELLSFTL+RLHKEPELLRVD+ERI+RQMQ Sbjct: 8 AAEDSSAVAS-LLPLASGAQQPYVSELLSFTLDRLHKEPELLRVDAERIQRQMQ 60 >gb|EYU20335.1| hypothetical protein MIMGU_mgv11b016288mg [Mimulus guttatus] Length = 171 Score = 84.3 bits (207), Expect = 2e-14 Identities = 42/54 (77%), Positives = 48/54 (88%) Frame = +1 Query: 307 SSEDSTMVASSLLPLASVAQQPYVSELLSFTLERLHKEPELLRVDSERIRRQMQ 468 +S D+ S+LLPLAS AQQPYVSELLSFTL+RLHKEPELL+VD+ERIRRQMQ Sbjct: 8 ASSDAYTEMSNLLPLASAAQQPYVSELLSFTLDRLHKEPELLKVDAERIRRQMQ 61 >ref|XP_002516094.1| Conserved oligomeric Golgi complex component, putative [Ricinus communis] gi|223544580|gb|EEF46096.1| Conserved oligomeric Golgi complex component, putative [Ricinus communis] Length = 574 Score = 83.6 bits (205), Expect = 3e-14 Identities = 40/51 (78%), Positives = 47/51 (92%) Frame = +1 Query: 316 DSTMVASSLLPLASVAQQPYVSELLSFTLERLHKEPELLRVDSERIRRQMQ 468 D T ++L+PLASV+QQPYVSELLSFTL+RLHKEPELLRVD+ERI+RQMQ Sbjct: 7 DDTSAMANLIPLASVSQQPYVSELLSFTLDRLHKEPELLRVDAERIQRQMQ 57 >gb|EXB57652.1| hypothetical protein L484_002999 [Morus notabilis] Length = 570 Score = 83.2 bits (204), Expect = 3e-14 Identities = 42/55 (76%), Positives = 50/55 (90%) Frame = +1 Query: 304 DSSEDSTMVASSLLPLASVAQQPYVSELLSFTLERLHKEPELLRVDSERIRRQMQ 468 D++E+++ V LLPLAS +QQPYVSELLSFTL+RLHKEPELLRVD+ERIRRQMQ Sbjct: 5 DAAEEASTVGG-LLPLASASQQPYVSELLSFTLDRLHKEPELLRVDAERIRRQMQ 58 >ref|XP_006345415.1| PREDICTED: conserved oligomeric Golgi complex subunit 8-like [Solanum tuberosum] Length = 577 Score = 82.8 bits (203), Expect = 4e-14 Identities = 42/59 (71%), Positives = 48/59 (81%), Gaps = 2/59 (3%) Frame = +1 Query: 298 SMDSSE--DSTMVASSLLPLASVAQQPYVSELLSFTLERLHKEPELLRVDSERIRRQMQ 468 SMDS + D + LPLAS +QQPY+SELLSFTL+RLHKEPELLRVD+ERIRRQMQ Sbjct: 2 SMDSEDPMDEASPVTGFLPLASASQQPYISELLSFTLDRLHKEPELLRVDAERIRRQMQ 60 >ref|XP_006453061.1| hypothetical protein CICLE_v10007867mg [Citrus clementina] gi|557556287|gb|ESR66301.1| hypothetical protein CICLE_v10007867mg [Citrus clementina] Length = 568 Score = 82.4 bits (202), Expect = 6e-14 Identities = 41/56 (73%), Positives = 51/56 (91%), Gaps = 1/56 (1%) Frame = +1 Query: 304 DSSEDSTMVA-SSLLPLASVAQQPYVSELLSFTLERLHKEPELLRVDSERIRRQMQ 468 + +D+T + +SLLPLAS++QQPYVSELLSFTL+RLHKEPELLRVD+ERI+RQMQ Sbjct: 4 EKGDDATSASVASLLPLASLSQQPYVSELLSFTLDRLHKEPELLRVDAERIQRQMQ 59 >ref|XP_006474432.1| PREDICTED: conserved oligomeric Golgi complex subunit 8-like [Citrus sinensis] gi|343887270|dbj|BAK61816.1| conserved oligomeric Golgi complex component [Citrus unshiu] Length = 568 Score = 82.0 bits (201), Expect = 8e-14 Identities = 41/56 (73%), Positives = 52/56 (92%), Gaps = 1/56 (1%) Frame = +1 Query: 304 DSSEDSTMVA-SSLLPLASVAQQPYVSELLSFTLERLHKEPELLRVDSERIRRQMQ 468 ++ +D+T + +SLLPLAS++QQPYVSELLSFTL+RLHKEPELLRVD+ERI+RQMQ Sbjct: 4 ETGDDATSSSVASLLPLASLSQQPYVSELLSFTLDRLHKEPELLRVDAERIQRQMQ 59 >ref|XP_007012332.1| Oligomeric Golgi complex component-related / COG complex component-related isoform 3, partial [Theobroma cacao] gi|508782695|gb|EOY29951.1| Oligomeric Golgi complex component-related / COG complex component-related isoform 3, partial [Theobroma cacao] Length = 427 Score = 81.6 bits (200), Expect = 1e-13 Identities = 40/49 (81%), Positives = 45/49 (91%) Frame = +1 Query: 322 TMVASSLLPLASVAQQPYVSELLSFTLERLHKEPELLRVDSERIRRQMQ 468 T + LLPLASV+QQPYVSELLSFTL+RLHKEPELLRVD+ERI+RQMQ Sbjct: 19 TSAMAGLLPLASVSQQPYVSELLSFTLDRLHKEPELLRVDAERIQRQMQ 67 >ref|XP_007012331.1| Oligomeric Golgi complex component-related / COG complex component-related isoform 2 [Theobroma cacao] gi|508782694|gb|EOY29950.1| Oligomeric Golgi complex component-related / COG complex component-related isoform 2 [Theobroma cacao] Length = 435 Score = 81.6 bits (200), Expect = 1e-13 Identities = 40/49 (81%), Positives = 45/49 (91%) Frame = +1 Query: 322 TMVASSLLPLASVAQQPYVSELLSFTLERLHKEPELLRVDSERIRRQMQ 468 T + LLPLASV+QQPYVSELLSFTL+RLHKEPELLRVD+ERI+RQMQ Sbjct: 19 TSAMAGLLPLASVSQQPYVSELLSFTLDRLHKEPELLRVDAERIQRQMQ 67 >ref|XP_007012330.1| Oligomeric Golgi complex component-related / COG complex component-related isoform 1 [Theobroma cacao] gi|508782693|gb|EOY29949.1| Oligomeric Golgi complex component-related / COG complex component-related isoform 1 [Theobroma cacao] Length = 583 Score = 81.6 bits (200), Expect = 1e-13 Identities = 40/49 (81%), Positives = 45/49 (91%) Frame = +1 Query: 322 TMVASSLLPLASVAQQPYVSELLSFTLERLHKEPELLRVDSERIRRQMQ 468 T + LLPLASV+QQPYVSELLSFTL+RLHKEPELLRVD+ERI+RQMQ Sbjct: 19 TSAMAGLLPLASVSQQPYVSELLSFTLDRLHKEPELLRVDAERIQRQMQ 67 >ref|XP_004141327.1| PREDICTED: conserved oligomeric Golgi complex subunit 8-like [Cucumis sativus] gi|449525202|ref|XP_004169607.1| PREDICTED: conserved oligomeric Golgi complex subunit 8-like [Cucumis sativus] Length = 570 Score = 80.9 bits (198), Expect = 2e-13 Identities = 40/58 (68%), Positives = 52/58 (89%) Frame = +1 Query: 295 QSMDSSEDSTMVASSLLPLASVAQQPYVSELLSFTLERLHKEPELLRVDSERIRRQMQ 468 ++ ++ E ++ AS+LLPLAS AQQPYVSELLSFTL+RL+KEPELL+VD+ERIRRQ+Q Sbjct: 2 ETENADELASSTASTLLPLASAAQQPYVSELLSFTLDRLNKEPELLQVDAERIRRQIQ 59 >ref|XP_004509412.1| PREDICTED: conserved oligomeric Golgi complex subunit 8-like [Cicer arietinum] Length = 578 Score = 80.1 bits (196), Expect = 3e-13 Identities = 41/50 (82%), Positives = 44/50 (88%) Frame = +1 Query: 319 STMVASSLLPLASVAQQPYVSELLSFTLERLHKEPELLRVDSERIRRQMQ 468 S M S LPLAS +QQPYVSELLSFTL+RLHKEPELLRVD+ERIRRQMQ Sbjct: 10 SDMEVSVSLPLASESQQPYVSELLSFTLDRLHKEPELLRVDAERIRRQMQ 59 >ref|NP_001066940.1| Os12g0538300 [Oryza sativa Japonica Group] gi|77556536|gb|ABA99332.1| Dor1-like family protein, expressed [Oryza sativa Japonica Group] gi|113649447|dbj|BAF29959.1| Os12g0538300 [Oryza sativa Japonica Group] gi|125579600|gb|EAZ20746.1| hypothetical protein OsJ_36370 [Oryza sativa Japonica Group] gi|215695214|dbj|BAG90405.1| unnamed protein product [Oryza sativa Japonica Group] Length = 610 Score = 80.1 bits (196), Expect = 3e-13 Identities = 39/59 (66%), Positives = 48/59 (81%) Frame = +1 Query: 292 NQSMDSSEDSTMVASSLLPLASVAQQPYVSELLSFTLERLHKEPELLRVDSERIRRQMQ 468 + S S+ + M +S+LPLA A QPYVSELLSF++ERLHKEPELLRVD+ER+RRQMQ Sbjct: 15 SSSSSSAAAADMSGASVLPLAGAAYQPYVSELLSFSIERLHKEPELLRVDAERVRRQMQ 73 >gb|EAY83387.1| hypothetical protein OsI_38603 [Oryza sativa Indica Group] Length = 610 Score = 80.1 bits (196), Expect = 3e-13 Identities = 39/59 (66%), Positives = 48/59 (81%) Frame = +1 Query: 292 NQSMDSSEDSTMVASSLLPLASVAQQPYVSELLSFTLERLHKEPELLRVDSERIRRQMQ 468 + S S+ + M +S+LPLA A QPYVSELLSF++ERLHKEPELLRVD+ER+RRQMQ Sbjct: 15 SSSSSSAAAADMSGASVLPLAGAAYQPYVSELLSFSIERLHKEPELLRVDAERVRRQMQ 73