BLASTX nr result
ID: Papaver25_contig00043517
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver25_contig00043517 (513 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002509827.1| conserved hypothetical protein [Ricinus comm... 57 3e-06 ref|XP_002515332.1| conserved hypothetical protein [Ricinus comm... 56 5e-06 >ref|XP_002509827.1| conserved hypothetical protein [Ricinus communis] gi|223549726|gb|EEF51214.1| conserved hypothetical protein [Ricinus communis] Length = 208 Score = 57.0 bits (136), Expect = 3e-06 Identities = 23/49 (46%), Positives = 34/49 (69%) Frame = -2 Query: 149 GQFSNYKPKVDFPRFDGTNPRAWIRKCKKYFFLHQMNDKQKVHMATLYL 3 G PKV+ F+G NPR WI+KC+KYF L+ + ++QK+ +A+LYL Sbjct: 102 GSMGGRIPKVELSHFEGNNPRLWIKKCEKYFQLYSIPNEQKIDIASLYL 150 >ref|XP_002515332.1| conserved hypothetical protein [Ricinus communis] gi|223545812|gb|EEF47316.1| conserved hypothetical protein [Ricinus communis] Length = 171 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/42 (57%), Positives = 32/42 (76%) Frame = -2 Query: 134 YKPKVDFPRFDGTNPRAWIRKCKKYFFLHQMNDKQKVHMATL 9 Y PK+ FP+FDG+N R WI+KC KYF ++ DKQKV +A+L Sbjct: 31 YIPKLKFPKFDGSNLRQWIKKCCKYFVFCKIPDKQKVDLASL 72