BLASTX nr result
ID: Papaver25_contig00043314
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver25_contig00043314 (467 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_064047.1| orf169 gene product (mitochondrion) [Beta vulga... 56 5e-06 >ref|NP_064047.1| orf169 gene product (mitochondrion) [Beta vulgaris subsp. vulgaris] gi|323435071|ref|YP_004222289.1| hypothetical protein BevumaM_p051 [Beta vulgaris subsp. maritima] gi|346683271|ref|YP_004842203.1| hypothetical protein BemaM_p159 [Beta macrocarpa] gi|9049347|dbj|BAA99357.1| orf169 [Beta vulgaris subsp. vulgaris] gi|317905724|emb|CBJ14109.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|319439804|emb|CBJ17516.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|345500189|emb|CBX25008.1| hypothetical protein [Beta macrocarpa] gi|384939187|emb|CBL52034.1| hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] Length = 169 Score = 56.2 bits (134), Expect = 5e-06 Identities = 25/38 (65%), Positives = 29/38 (76%) Frame = -2 Query: 148 IYRIFCKCNLQIRDQNKA*QKRKYHGTSSFPKMEFSCW 35 +YRIF N Q RDQ++A Q RKYHGTSSF +ME SCW Sbjct: 1 MYRIFSTYNHQTRDQSRARQNRKYHGTSSFTEMELSCW 38