BLASTX nr result
ID: Papaver25_contig00042962
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver25_contig00042962 (596 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007030857.1| Peroxisomal adenine nucleotide carrier 1 [Th... 57 5e-06 >ref|XP_007030857.1| Peroxisomal adenine nucleotide carrier 1 [Theobroma cacao] gi|508719462|gb|EOY11359.1| Peroxisomal adenine nucleotide carrier 1 [Theobroma cacao] Length = 345 Score = 56.6 bits (135), Expect = 5e-06 Identities = 33/60 (55%), Positives = 39/60 (65%), Gaps = 2/60 (3%) Frame = +2 Query: 167 RNLFGVI*EDFST--ICIIVPRAWDKQLQSFTA*FVYWYGYNYFKKLYLRKS*SNSIGTR 340 RNL V+ E ST I + K LQSF A FVY+YGY+YFK+LYL KS S SIGT+ Sbjct: 48 RNLSDVLWEAISTRQILSLYQGLGTKNLQSFIAQFVYFYGYSYFKRLYLEKSGSKSIGTK 107