BLASTX nr result
ID: Papaver25_contig00042948
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver25_contig00042948 (651 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN67224.1| hypothetical protein VITISV_029053 [Vitis vinifera] 57 6e-06 emb|CAN61757.1| hypothetical protein VITISV_030741 [Vitis vinifera] 56 8e-06 emb|CAN66642.1| hypothetical protein VITISV_008302 [Vitis vinifera] 56 8e-06 emb|CAN66166.1| hypothetical protein VITISV_000142 [Vitis vinifera] 56 8e-06 >emb|CAN67224.1| hypothetical protein VITISV_029053 [Vitis vinifera] Length = 1120 Score = 56.6 bits (135), Expect = 6e-06 Identities = 38/92 (41%), Positives = 55/92 (59%), Gaps = 4/92 (4%) Frame = +3 Query: 75 AEVDQLISMLVLINH---SPTVLYDQPDSRSWVPSPSGLFSVKSTYNSIMVSSAVIPAIS 245 +E++ L S+L ++H SP+V PD RSW SPSGLF+VK + ++ S +P+I Sbjct: 978 SEIEDLESLLRSLDHLHLSPSV----PDKRSWSLSPSGLFTVKYFFLALSQFSG-LPSI- 1031 Query: 246 FPSKTTWNLNVPPK-MSFYWTSALDKIPTQEI 338 FP+K WN VP K SF W A K+ T ++ Sbjct: 1032 FPTKLVWNSQVPFKTKSFVWLVAHKKVNTNDM 1063 >emb|CAN61757.1| hypothetical protein VITISV_030741 [Vitis vinifera] Length = 1306 Score = 56.2 bits (134), Expect = 8e-06 Identities = 35/88 (39%), Positives = 51/88 (57%), Gaps = 1/88 (1%) Frame = +3 Query: 78 EVDQLISMLVLINHSPTVLYDQPDSRSWVPSPSGLFSVKSTYNSIMVSSAVIPAISFPSK 257 +++ L+ L ++ SP+V PD RSW SPSGLF+VKS + ++ S P FP+K Sbjct: 1083 DLESLMRSLDRLHISPSV----PDKRSWSISPSGLFTVKSFFLALSQHSESPPV--FPTK 1136 Query: 258 TTWNLNVPPKM-SFYWTSALDKIPTQEI 338 WN VP K+ SF W A K+ T ++ Sbjct: 1137 FVWNSQVPFKVKSFVWLVAHKKLNTNDL 1164 >emb|CAN66642.1| hypothetical protein VITISV_008302 [Vitis vinifera] Length = 611 Score = 56.2 bits (134), Expect = 8e-06 Identities = 34/88 (38%), Positives = 52/88 (59%), Gaps = 1/88 (1%) Frame = +3 Query: 78 EVDQLISMLVLINHSPTVLYDQPDSRSWVPSPSGLFSVKSTYNSIMVSSAVIPAISFPSK 257 +++ L+ L ++ SP+V PD RSW SPSGLF+VKS + ++ + + P FP+K Sbjct: 492 DLESLMRSLDRLHLSPSV----PDKRSWSISPSGLFTVKSFFLALSQYAELPPV--FPTK 545 Query: 258 TTWNLNVPPKM-SFYWTSALDKIPTQEI 338 WN VP K+ SF W A K+ T ++ Sbjct: 546 FVWNSQVPFKVKSFVWLVAHKKVNTNDL 573 >emb|CAN66166.1| hypothetical protein VITISV_000142 [Vitis vinifera] Length = 533 Score = 56.2 bits (134), Expect = 8e-06 Identities = 35/88 (39%), Positives = 51/88 (57%), Gaps = 1/88 (1%) Frame = +3 Query: 78 EVDQLISMLVLINHSPTVLYDQPDSRSWVPSPSGLFSVKSTYNSIMVSSAVIPAISFPSK 257 +++ L+ L ++ SP+V PD RSW SPSGLF+VKS + ++ S P FP+K Sbjct: 390 DLESLMRSLDRLHISPSV----PDKRSWSISPSGLFTVKSFFLALSQHSESPPV--FPTK 443 Query: 258 TTWNLNVPPKM-SFYWTSALDKIPTQEI 338 WN VP K+ SF W A K+ T ++ Sbjct: 444 FVWNSQVPFKVKSFVWLVAHKKLNTNDL 471