BLASTX nr result
ID: Papaver25_contig00041146
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver25_contig00041146 (466 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003545007.2| PREDICTED: prolyl endopeptidase-like [Glycin... 60 4e-07 gb|EXB88229.1| Prolyl endopeptidase [Morus notabilis] 56 5e-06 >ref|XP_003545007.2| PREDICTED: prolyl endopeptidase-like [Glycine max] Length = 762 Score = 59.7 bits (143), Expect = 4e-07 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -1 Query: 94 DMQHVLLYIEESCDPVNKLYYCDLSTLPNGL 2 D ++VLLYIEE CDPVNKLYYCDLS LPNGL Sbjct: 284 DGKYVLLYIEEGCDPVNKLYYCDLSELPNGL 314 >gb|EXB88229.1| Prolyl endopeptidase [Morus notabilis] Length = 729 Score = 56.2 bits (134), Expect = 5e-06 Identities = 23/31 (74%), Positives = 27/31 (87%) Frame = -1 Query: 94 DMQHVLLYIEESCDPVNKLYYCDLSTLPNGL 2 D ++VLLYI+E CDPVNK YYCD+S LPNGL Sbjct: 252 DGKYVLLYIDEGCDPVNKFYYCDMSELPNGL 282